spacer

EBI Dbfetch

ID   AM261865; SV 1; linear; genomic DNA; STD; HUM; 1163 BP.
XX
AC   AM261865;
XX
DT   05-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*11new
DE   allele, exons 2-4
XX
KW   HLA-A gene; HLA-A*11new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1163
RA   Danzer M.;
RT   ;
RL   Submitted (05-MAY-2006) to the INSDC.
RL   Danzer M., Immungenetic Lab, Red Cross Transfusion Service,
RL   Krankenhausstrasse 9, Linz, A-4017, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00827.x.
RX   PUBMED; 17498273.
RA   Danzer M., Polin H., Hofer K., Gabriel C.;
RT   "HLA-A*1129, a new allele identified in a cord blood donor";
RL   Tissue Antigens 69(6):611-611(2007).
XX
DR   MD5; 6847d2cb33df73d13d973ac13e400cd1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1163
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,512..787,888..>1163)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11new"
FT   CDS             join(<1..270,512..787,888..>1163)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting function"
FT                   /db_xref="GOA:A0JHM7"
FT                   /db_xref="IMGT/HLA:A*11:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0JHM7"
FT                   /protein_id="CAK12753.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYQENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11new"
FT                   /number=2
FT   intron          271..511
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11new"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11new"
FT                   /number=3
FT   gap             788..887
FT                   /estimated_length=unknown
FT   exon            888..1163
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11new"
FT                   /number=4
XX
SQ   Sequence 1163 BP; 204 A; 337 C; 372 G; 150 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg ctggccccga ccccgcggtc agcccagtcc       300
     cccaagccct gcccggcccc gaccaacccg gggggatttt tggcctaaac tgaaaatgaa       360
     accgggtaaa ggcgcctggg cctctcccgg ggcaagggtc tcggggtccc gcggcttcgg       420
     ggtggatctc ggacccggag actgtgggcc acctggcccg tccgtggggg atgaggggtc       480
     gtgacctgcg ccccgggccg gggtcactca cgttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggcc catgcggcgg agcagcagag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga taccaggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnacc cccccaagac       900
     acatatgacc caccacccca tctctgacca tgaggccacc ctgaggtgct gggccctggg       960
     cttctaccct gcggagatca cactgacctg gcagcgggat ggggaggacc agacccagga      1020
     cacggagctc gtggagacca ggcctgcagg ggatggaacc ttccagaagt gggcggctgt      1080
     ggtggtgcct tctggagagg agcagagata cacctgccat gtgcagcatg agggtctgcc      1140
     caagcccctc accctgagat ggg                                              1163
//


spacer
spacer