Dbfetch

ID   AM261864; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM261864;
XX
DT   04-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class 1 antigen, HLA-Cw*07new
DE   allele, exons 2 and 3
XX
KW   HLA-Cw gene; HLA-Cw*07new allele; major histocompatibility complex;
KW   MHC class 1 antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Danzer M.;
RT   ;
RL   Submitted (04-MAY-2006) to the INSDC.
RL   Danzer M., Immungenetic Lab, Red Cross Transfusion Service,
RL   Krankenhausstrasse 9, Linz, A-4017, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00734.x.
RX   PUBMED; 17212714.
RA   Danzer M., Polin H., Schroder S., Mytilineos J., Gabriel C.;
RT   "HLA-Cw*0740, a new allele mistyped by generic sequencing and identified by
RT   allelic separation";
RL   Tissue Antigens 69(1):100-102(2007).
XX
DR   MD5; 182b0602abd3c5b7947f376109f78aab.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class 1 antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q08GM9"
FT                   /db_xref="IMGT/HLA:C*07:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q08GM9"
FT                   /protein_id="CAK12752.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQTDRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 106 A; 174 C; 196 G; 70 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcag                      646
//