spacer

EBI Dbfetch

ID   AM261745; SV 1; linear; genomic DNA; STD; HUM; 2738 BP.
XX
AC   AM261745;
XX
DT   11-MAY-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*38new allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*38new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2738
RA   Bengtsson M.;
RT   ;
RL   Submitted (08-MAY-2006) to the INSDC.
RL   Bengtsson M., Dept. of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Egle Jansson I., Henrysson H., Bengtsson M.;
RT   "A new HLA-B*38 variant";
RL   Unpublished.
XX
DR   MD5; 7639a6e735e55ac574403a7970e113b4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2738
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   5'UTR           <1..63
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT   mRNA            join(<1..136,265..534,781..1056,1629..1904,1998..2114,
FT                   2556..2588,2695..>2738)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT   exon            <1..136
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=1
FT   CDS             join(64..136,265..534,781..1056,1629..1904,1998..2114,
FT                   2556..2588,2695..2738)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1JRH1"
FT                   /db_xref="IMGT/HLA:B*38:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JRH1"
FT                   /protein_id="CAK12620.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRENLRI
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   intron          137..264
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=1
FT   exon            265..534
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=2
FT   intron          535..780
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=2
FT   exon            781..1056
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=3
FT   intron          1057..1628
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=3
FT   exon            1629..1904
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=4
FT   intron          1905..1997
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=4
FT   exon            1998..2114
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=5
FT   intron          2115..2555
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=5
FT   exon            2556..2588
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=6
FT   intron          2589..2694
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=6
FT   exon            2695..>2738
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=7
XX
SQ   Sequence 2738 BP; 515 A; 822 C; 859 G; 542 T; 0 other;
     cggggtccca gttctaaagt ccccacgcac ccacccggac tcagagtctc ctcagacgcc        60
     gagatgctgg tcatggcgcc ccgaaccgtc ctcctgctgc tctcggcggc cctggccctg       120
     accgagacct gggccggtga gtgcgggtcg ggagggaaat ggcctctgcc gggaggagcg       180
     aggggaccgc aggcgggggc gcaggacctg aggagccgcg ccgggaggag ggtcgggcgg       240
     gtctcagccc ctcctcgccc ccaggctccc actccatgag gtatttctac acctccgtgt       300
     cccggcccgg ccgcggggag ccccgcttca tctcagtggg ctacgtggac gacacgcagt       360
     tcgtgaggtt cgacagcgac gccgcgagtc cgagagagga gccgcgggcg ccgtggatag       420
     agcaggaggg gccggaatat tgggaccgga acacacagat ctgcaagacc aacacacaga       480
     ctgaccgaga gaacctgcgg atcgcgctcc gctactacaa ccagagcgag gccggtgagt       540
     gaccccggcc cggggcgcag gtcacgactc cccatccccc acgtacggcc cgggtcgccc       600
     cgagtctccg ggtccgagat ccgcctccct gaggccgcgg gacccgccca gaccctcgac       660
     cggcgagagc cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc       720
     gggttggtcg gggcggggcg gggctcgggg ggacggggct gaccgcgggg ccggggccag       780
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc       840
     gcgggcataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       900
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       960
     gtgtggcgga gcagctgaga acctacctgg agggcacgtg cgtggagtgg ctccgcagat      1020
     acctggagaa cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt      1080
     ccccatctcc tataggtcgc cggggatggc ctccaacgag aagaagagga aaatgggatc      1140
     agcgctagaa tgtcgccctc ccttgaatgg agaatggcat gagttttcct gagtttcctc      1200
     tgagggcccc ctcttctctc taggacaatt aagggatgac gtctctgagg aaatggaggg      1260
     gaagacagtc cctagaatac tgatcagggg tcccctttga cccctgcagc agccttggga      1320
     accatgactt ttcctctcag gccttgttct ctgcctcaca ctcagtgtgt ttggggctct      1380
     gattccagca cttctgagtc actttacctc cactcagatc aggagcagaa gtctctgttc      1440
     cccgctcaga gactcgaact ttccaatgaa tagattatcc caggtgcctg cgtccaggct      1500
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1560
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1620
     cccatcagac cccccaaaga cacatgtgac ccaccacccc atctctgacc atgaggccac      1680
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1740
     tggcgaggac caaactcagg acaccgagct tgtggagacc agaccagcag gagacagaac      1800
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      1860
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1920
     ggggtcatat ctcttctcag ggaaagcagg agcccttcag cagggtcagg gcccctcatc      1980
     ttcccctcct ttcccagagc catcttccca gtccaccgtc cccatcgtgg gcattgttgc      2040
     tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctgctg tgatgtgtag      2100
     gaggaagagt tcaggtaggg aaggggtgag gggtggggtc tgggttttct tgtcccactg      2160
     ggggtttcaa gccccaggta gaagtgttcc ctgcatcatt actgggaagc agcatgcaca      2220
     caggggctaa cgcagcctgg gaccctgtgt gccagcactt actcttttgt gcagcacatg      2280
     tgacaatgaa ggacggatgt atcaccttga tggttgtggt gttggggtcc tgattccagc      2340
     attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca gttggtccag      2400
     gacccacact tgctttcctc gtgtttcctg atcctgccct gggtctgtag tcatacttct      2460
     ggaaattcct tttgggtcca agactaggag gttcctctaa gatctcatgg ccctgcttcc      2520
     tcccagtccc ctcacaggac attttcttcc cacaggtgga aaaggaggga gctactctca      2580
     ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct cacccacccc ataattcctc      2640
     ctgtcccacg tctcctgtgg gctctgacca ggtcctgttt ttgttctact ccagccagcg      2700
     acagtgccca gggctctgat gtgtctctca cagcttga                              2738
//


spacer
spacer