spacer

EBI Dbfetch

ID   AM261460; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM261460;
XX
DT   03-MAY-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-A*0301new,
DE   variant allele MVE0406, exons 2-3
XX
KW   A*0301new allele; HLA-A gene; human leucocyte antigen A;
KW   major histocompatibility complex. antigen; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Blasczyk R.;
RT   ;
RL   Submitted (02-MAY-2006) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   PUBMED; 17999654.
RA   Albis-Camps M., Blasczyk R., Horn P.A.;
RT   "Haplotype-specific sequence-based typing shows the novel allele
RT   HLA-A*030105";
RL   Tissue Antigens 71(1):85-86(2008).
XX
DR   MD5; 7fd4489a2635640a57760591b5d2ad2e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p31.3"
FT                   /isolate="MHHZ-00023171"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,371..646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301 variant allele MVE0406"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="variant allele MVE0406"
FT                   /db_xref="GOA:Q1M2R8"
FT                   /db_xref="IMGT/HLA:A*03:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1M2R8"
FT                   /protein_id="CAK02800.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301new"
FT                   /allele="HLA-A*0301 variant allele MVE0406"
FT                   /number=2
FT                   /note="variant allele MVE0406"
FT   intron          271..370
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301new"
FT                   /number=2
FT                   /note="variant allele MVE0406"
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301new"
FT                   /number=3
FT                   /note="variant allele MVE0406"
XX
SQ   Sequence 646 BP; 110 A; 161 C; 196 G; 79 T; 100 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccaa agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgaggcgga gcagttgaga gcctacctgg atggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer