spacer

EBI Dbfetch

ID   AM261439; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM261439;
XX
DT   02-AUG-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*04new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*04new allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (02-MAY-2006) to the INSDC.
RL   Poli F., Dipartimento di Medicina Rigenerativa, Fondazione IRCCS Ospedale
RL   Maggiore Polic, Via Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-DRB1*04";
RL   Unpublished.
XX
DR   MD5; aae0eef4214a8d6c888324b552b5466d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q0VUQ9"
FT                   /db_xref="IMGT/HLA:DRB1*04:60"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VUQ9"
FT                   /protein_id="CAK02791.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNNQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB*04new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 64 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacaaccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer