Dbfetch

ID   AM260212; SV 1; linear; genomic DNA; STD; HUM; 2962 BP.
XX
AC   AM260212;
XX
DT   25-APR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*44new allele, exons
DE   1-7
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2962
RA   Bengtsson M.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   Bengtsson M., Dep of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Egle Jansson I., Knutsson C., Bengtsson M.;
RT   "A new HLA-B variant with exons 1-2 identical to B*51 and exons 3-7 to
RT   B44";
RL   Unpublished.
XX
DR   MD5; 8253b5b1e485378dfeedfa598e677579.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2962
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   5'UTR           <1..78
FT                   /gene="HLA-B"
FT   CDS             join(79..151,281..550,794..1069,1645..1920,2014..2130,
FT                   2572..2604,2711..2754)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="HLA-B antigen"
FT                   /db_xref="GOA:Q1M309"
FT                   /db_xref="IMGT/HLA:B*51:42"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1M309"
FT                   /protein_id="CAJ91096.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            79..151
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=1
FT   variation       103
FT                   /allele="B*4406 allele"
FT                   /replace="c"
FT                   /compare=X83401.1
FT   intron          152..280
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=1
FT   exon            281..550
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   intron          551..793
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   exon            749..1069
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   exon            794..1069
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   variation       988..990
FT                   /replace="gac"
FT                   /compare=X83403.1
FT                   /note="compared to IMGT/HLA allele HLA-B*4406"
FT   intron          1070..1644
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   exon            1645..1920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   intron          1921..2013
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   exon            2014..2130
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=5
FT   intron          2131..2571
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=5
FT   exon            2572..2604
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=6
FT   intron          2605..2710
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=6
FT   exon            2711..2754
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=7
FT   3'UTR           2755..2962
FT                   /gene="HLA-B"
XX
SQ   Sequence 2962 BP; 551 A; 852 C; 953 G; 606 T; 0 other;
     gccaatcagc gtcgccgggg tcccagttct aaagtcccca cgcacccacc cggactcaga        60
     atctcctcag acgccgagat gcgggtcacg gcgccccgaa ccgtcctcct gctgctctgg       120
     ggggcagtgg ccctgaccga gacctgggcc ggtgagtgcg gggtcgggag ggaaatggcc       180
     tctgtgggga ggagcgaggg gaccgcaggc gggggcgcag gacctgagga gccgcgccgg       240
     gaggagggtc gggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat       300
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcattgc agtgggctac       360
     gtggacgaca cccagttcgt gaggttcgac agcgacgccg cgagtccgag gacggagccc       420
     cgggcgccat ggatagagca ggaggggccg gagtattggg accggaacac acagatcttc       480
     aagaccaaca cacagactta ccgagagaac ctgcggatcg cgctccgcta ctacaaccag       540
     agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt       600
     acggcccggg tcgccccgag tctccgggtc cgagatccgc ccccgaggcc gcgggacccg       660
     cccagaccct cgaccggcga gagccccagg cgcgtttacc cggtttcatt ttcagttgag       720
     gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc gggggacggg gctgaccgcg       780
     gggccggggc cagggtctca catcatccag aggatgtacg gctgcgacgt ggggccggac       840
     gggcgcctcc tccgcgggta tgaccaggac gcctacgacg gcaaggatta catcgccctg       900
     aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       960
     tgggaggcgg cccgtgtggc ggagcagctg agagcctacc tggagggcct gtgcgtggag      1020
     tcgctccgca gatacctgga gaacgggaag gagacgctgc agcgcgcggg taccaggggc      1080
     agtggggagc cttccccatc tcctataggt cgccggggat ggcctcccac gagaagagga      1140
     ggaaaatggg atcagcgcta gaatgtcgcc ctcccttgaa tggagaatgg catgagtttt      1200
     cctgagtttc ctctgagggc cccctcttct ctctaggaca attaagggat gacgtctctg      1260
     aggaaatgga ggggaagaca gtccctagaa tactgatcag gggtcccctt tgacccctgc      1320
     agcagccttg ggaaccgtga cttttcctct caggccttgt tctctgcctc acactcagtg      1380
     tgtttggggc tctgattcca gcacttctga gtcactttac ctccactcag atcaggagca      1440
     gaagtccctg ttccccgctc agagactcga actttccaat gaataggaga ttatcccagg      1500
     tgcctgcgtc caggctggtg tctgggttct gtgccccttc cccaccccag gtgtcctgtc      1560
     cattctcagg ctggtcacat gggtggtcct agggtgtccc atgagagatg caaagcgcct      1620
     gaattttctg actcttccca tcagaccccc caaagacaca tgtgacccac caccccatct      1680
     ctgaccatga ggtcaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac      1740
     tgacctggca gcgggatggc gaggaccaaa ctcaggacac cgagcttgtg gagaccagac      1800
     cagcaggaga tagaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaagagc      1860
     agagatacac atgccatgta cagcatgagg ggctgccgaa gcccctcacc ctgagatggg      1920
     gtaaggaggg ggatgagggg tcatatctct tctcagggaa agcaggagcc cttcagcagg      1980
     gtcagggccc ctcatcttcc cttcctttcc cagagccgtc ttcccagtcc accgtcccca      2040
     tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt ggtcatcgga gctgtggtcg      2100
     ctgctgtgat gtgtaggagg aagagctcag gtagggaagg ggtgaggggt ggggtctggg      2160
     ttttcttgtc ccactggggg tttcaagccc caggtagaag tgttccctgc ctcattactg      2220
     ggaagcagca tccacacagg ggctaacgca gcctgggacc ctgtgtgcca gcacttactc      2280
     ttttgtgcag cacatgtgac aatgaaggac ggatgtatca ccgtggtggt tgtggtgttg      2340
     gggtcctgat tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg      2400
     agggcagttg gtccaggacc cacacttgct ttcctcgtgt ttcctgatcc tgccttgggt      2460
     ctgtagtcat acttctggaa attccttttg ggtccaagac gaggaggttc ctctaagatc      2520
     tcatggccct gcttcctccc agtcccctca cagggcattt tcttcccaca ggtggaaaag      2580
     gagggagcta ctctcaggct gcgtgtaagt gatgggggcg ggagtgtgga ggagctcacc      2640
     caccccataa ttcctcctgt cccacgtctc ctgcgggctc tgaccaggtc ctgtttttgt      2700
     tctactccag gcagcgacag tgcccagggc tctgatgtgt ctctcacagc ttgaaaaggt      2760
     gagattcttg gggtctagag tgggtggggt ggcaggtctg ggggtgggtg gggcagtggg      2820
     gaaaggcctg ggtaatggag attctttgat tgggatgttt cgcgtgtgtg gtgggctgtt      2880
     tagagtgtca tcacttacca tgactaacca gaatttgttc atgactgttg ttttctgtag      2940
     cctgagacag ctgtcttgtg ag                                               2962
//