Dbfetch

ID   AM259942; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM259942;
XX
DT   26-APR-2006 (Rel. 87, Created)
DT   09-JUN-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*05new
DE   allele, exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1*05new allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dubois V.;
RT   ;
RL   Submitted (19-APR-2006) to the INSDC.
RL   Dubois V., HLA, EFS Rhone Alpes, 1 et 3 rue du Vercors, 69007 Lyon, FRANCE.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01248.x.
RX   PUBMED; 19392794.
RA   Giannoli C., Paturel L., Favre-Victoire I., Bera O., Dubois V.;
RT   "Two new HLA-DQB alleles routinely identified by sequence-based typing:
RT   DQB1*030103 and DQB1*0505";
RL   Tissue Antigens 73(6):622-623(2009).
XX
DR   MD5; 87337655a7fad42dd780efd3773166d6.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Martinique"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05new"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*05:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAJ90956.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPSAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 67 C; 105 G; 40 T; 0 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag                                        270
//