spacer

EBI Dbfetch

ID   AM259941; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM259941;
XX
DT   26-APR-2006 (Rel. 87, Created)
DT   09-JUN-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*03new
DE   allele, exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1*03new allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dubois V.;
RT   ;
RL   Submitted (19-APR-2006) to the INSDC.
RL   Dubois V., HLA, EFS Rhone Alpes, 1 et 3 rue du Vercors, 69007 Lyon, FRANCE.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01248.x.
RX   PUBMED; 19392794.
RA   Giannoli C., Paturel L., Favre-Victoire I., Bera O., Dubois V.;
RT   "Two new HLA-DQB alleles routinely identified by sequence-based typing:
RT   DQB1*030103 and DQB1*0505";
RL   Tissue Antigens 73(6):622-623(2009).
XX
DR   MD5; c7d325e17942c1a566a39feb6e4cb2f7.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Tr; ENST00000399065; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000424530; homo_sapiens.
DR   Ensembl-Tr; ENST00000480749; homo_sapiens.
DR   EuropePMC; PMC3716684; 23894623.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="multiple sclerosis patient"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1M313"
FT                   /db_xref="IMGT/HLA:DQB1*03:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q1M313"
FT                   /protein_id="CAJ90955.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03"
FT                   /number=2
XX
SQ   Sequence 270 BP; 62 A; 72 C; 91 G; 45 T; 0 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cccctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer