spacer

EBI Dbfetch

ID   AM259370; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AM259370;
XX
DT   19-APR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*15new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Woelpl A.;
RT   ;
RL   Submitted (18-APR-2006) to the INSDC.
RL   Woelpl A., Immunogenetics, Laboratory for Medical Genetics, Lochhamer Str.
RL   29, 82152 Martinsried, GERMANY.
XX
RN   [2]
RA   Hoelsch K.;
RT   "Routine HLA-B genotyping with PCR-sequence-specific oligonucleotides
RT   detects a B*15 variant";
RL   Unpublished.
XX
DR   MD5; 8ec206ee8e6297a4ffe5330c17422b03.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1RP37"
FT                   /db_xref="IMGT/HLA:B*15:116"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1RP37"
FT                   /protein_id="CAJ90723.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /number=3
XX
SQ   Sequence 791 BP; 139 A; 266 C; 281 G; 105 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggcctgg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc tcccagcgca agttggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer