Dbfetch

ID   AM258966; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM258966;
XX
DT   06-MAY-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*15new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*15new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Joosten I.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   Joosten I., ABTI 603, University Medical Center St Radboud, P.O. Box 9101,
RL   6500 HB Nijmegen, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00674.x.
RX   PUBMED; 17026475.
RA   Tijssen H.J., van der Zeeuw-Hingrez S.C., van Houwelingen K.P.,
RA   Allebes W.A., Joosten I.;
RT   "Exon 2 sequence analysis of a novel HLA-DRB1 allele, DRB1*1520";
RL   Tissue Antigens 68(4):347-348(2006).
XX
DR   MD5; e1dec72af17c0bb1c40a2b44c6950a0f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15new"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1JRP4"
FT                   /db_xref="IMGT/HLA:DRB1*15:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JRP4"
FT                   /protein_id="CAJ90451.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYRVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 66 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacaggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//