spacer

EBI Dbfetch

ID   AM237310; SV 1; circular; genomic DNA; STD; VRT; 17037 BP.
XX
AC   AM237310;
XX
DT   24-OCT-2006 (Rel. 89, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Apus apus complete mitochondrial genome
XX
KW   12S ribosomal RNA; 12S rRNA gene; 16S ribosomal RNA; 16S rRNA gene;
KW   ATPase 6 gene; ATPase 8 gene; ATPase subunit 6; ATPase subunit 8; COI gene;
KW   COII gene; COIII gene; control region; cytb gene; cytochrome b;
KW   cytochrome oxidase subunit I; cytochrome oxidase subunit II;
KW   cytochrome oxidase subunit III; internal transcribed spacer 1; ITS1;
KW   NADH dehydrogenase subunit 1; NADH dehydrogenase subunit 2;
KW   NADH dehydrogenase subunit 3; NADH dehydrogenase subunit 4;
KW   NADH dehydrogenase subunit 4L; NADH dehydrogenase subunit 5;
KW   NADH dehydrogenase subunit 6; NADH1 gene; NADH2 gene; NADH3 gene;
KW   NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; transfer RNA-Ala;
KW   transfer RNA-Arg; transfer RNA-Asn; transfer RNA-Asp; transfer RNA-Cys;
KW   transfer RNA-Gln; transfer RNA-Glu; transfer RNA-Gly; transfer RNA-His;
KW   transfer RNA-Ile; transfer RNA-Leu; transfer RNA-Lys; transfer RNA-Met;
KW   transfer RNA-Phe; transfer RNA-Pro; transfer RNA-Ser; transfer RNA-Thr;
KW   transfer RNA-Trp; transfer RNA-Tyr; transfer RNA-Val; tRNA-Ala gene;
KW   tRNA-Arg gene; tRNA-Asn gene; tRNA-Asp gene; tRNA-Cys gene; tRNA-Gln gene;
KW   tRNA-Glu gene; tRNA-Gly gene; tRNA-His gene; tRNA-Ile gene; tRNA-Leu gene;
KW   tRNA-Lys gene; tRNA-Met gene; tRNA-Phe gene; tRNA-Pro gene; tRNA-Ser gene;
KW   tRNA-Thr gene; tRNA-Trp gene; tRNA-Tyr gene; tRNA-Val gene.
XX
OS   Apus apus (common swift)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Apodiformes; Apodidae; Apus.
OG   Mitochondrion
XX
RN   [1]
RP   1-17037
RA   Bartosch-Haerlid A.;
RT   ;
RL   Submitted (27-MAR-2006) to the INSDC.
RL   Bartosch-Haerlid A., Department of Cell and Organism Biology, Division of
RL   Evolutionary Molecular Syste, Soelvegatan 29, S-223 62 Lund, SWEDEN.
XX
RN   [2]
RA   Slack K.E., Delsuc F., McLenachan P.A., Bartosch-Haerlid A., Arnason U.,
RA   Penny D.;
RT   "Resolving the root of the avian mitogenomic tree by breaking up long
RT   branches";
RL   Unpublished.
XX
DR   MD5; 3cf99c5d3c96f30c40de6cf0c3dcff13.
DR   EuropePMC; PMC2259304; 18215323.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..17037
FT                   /organism="Apus apus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Sweden"
FT                   /db_xref="taxon:8895"
FT   tRNA            1..71
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:30..32,aa:Phe)"
FT   rRNA            72..1041
FT                   /gene="12S rRNA"
FT                   /product="12S ribosomal RNA"
FT   misc_feature    1042..1114
FT                   /note="internal transcribed spacer 1, ITS1"
FT   tRNA            1042..1114
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:1071..1073,aa:Val)"
FT   rRNA            1115..2716
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            2717..2790
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:2752..2754,aa:Leu)"
FT   CDS             2800..3777
FT                   /transl_table=2
FT                   /gene="NADH1"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /db_xref="GOA:A0AB42"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB42"
FT                   /protein_id="CAJ86552.1"
FT                   /translation="MNHSPLLTYLTMSLSYAIPILIAVAFLTLVERKVLSYMQARKGPN
FT                   IVGPFGLLQPVADGVKLFIKEPVRPSTSSPLLFIMTPMLALLLAITIWIPLPLPFPLTD
FT                   LNLGLLFLLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVIML
FT                   SGNYTLNTLATTQEPLYLIFSSWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEY
FT                   AAGPFALFFLAEYANIMLMNTLTAILFLNPSSLNSSTELFPIILASKTLLLSSGFLWIR
FT                   ASYPRFRYDQLMHLLWKNFLPLTLALCLWHTSMPICYAALPPHS"
FT   tRNA            3776..3848
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:3806..3808,aa:Ile)"
FT   tRNA            complement(3862..3932)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:3897..3899,aa:Gln)"
FT   tRNA            3932..4001
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:3962..3964,aa:Met)"
FT   CDS             4008..5048
FT                   /transl_table=2
FT                   /gene="NADH2"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /db_xref="GOA:Q6WDR4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WDR4"
FT                   /protein_id="CAJ86553.1"
FT                   /translation="MNPYAKLIFTMSLLLGTTMTISSNHWMMAWTGLEINTLAIIPLIA
FT                   KHHHPRAIEAAIKYFLTQAAASTLLLFSSTINAWSSGQWDITQLNHPIACTLLTTAIAM
FT                   KLGLVPFHFWFPEVLQGSSLTTAMLLSTVMKFPPITILFMTSPSLNPTLLSIMAIASTA
FT                   LGGWMGLNQTQVRKILAFSSISHLGWMALILIYNPKLTLLTFYVYCLMTITVFLTLNTT
FT                   KTLKLSTMMTSWTKTPTLNATLMMTLLSLAGLPPLTGFLPKWLTIQELTKQEMTSAATL
FT                   IAILSLLGLFFYLRLAYYSTITLPPNPTNHMKQWHFYKPTNTLIPILTSLSALLLPLSP
FT                   MILTIT"
FT   tRNA            5047..5116
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:5084..5086,aa:Trp)"
FT   tRNA            complement(5118..5186)
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:5154..5156,aa:Ala)"
FT   tRNA            complement(5189..5262)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:5226..5228,aa:Asn)"
FT   tRNA            complement(5265..5331)
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT                   /anticodon="(pos:5301..5303,aa:Cys)"
FT   tRNA            complement(5331..5401)
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:5367..5369,aa:Tyr)"
FT   CDS             5403..6953
FT                   /transl_table=2
FT                   /gene="COI"
FT                   /product="cytochrome oxidase subunit I"
FT                   /db_xref="GOA:A0AB44"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB44"
FT                   /protein_id="CAJ86554.1"
FT                   /translation="MTYINRWLFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELGQP
FT                   GTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFW
FT                   LLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGVSSILGAI
FT                   NFITTAINMKPPALSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFD
FT                   PAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVAYYAGKKEPFGYMGMVWAMLSI
FT                   GFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPIGIKVFSWLATLHGGTIKWDPPML
FT                   WALGFIFLFTIGGLTGIILANSSLDIALHDTYYVVAHFHYVLSMGAVFAILAGFTHWFP
FT                   LFTGYTLHQTWSKAHFGVMFAGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTLSSIG
FT                   SLISMTAVIMLMFIIWEAFASKRKVLQPELTATNIEWIHGCPPPYHTFEEPAFVQIQE"
FT   tRNA            complement(6945..7018)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:6981..6983,aa:Ser)"
FT   tRNA            7021..7089
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:7049..7051,aa:Asp)"
FT   CDS             7092..7775
FT                   /transl_table=2
FT                   /gene="COII"
FT                   /product="cytochrome oxidase subunit II"
FT                   /db_xref="GOA:A0AB45"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB45"
FT                   /protein_id="CAJ86555.1"
FT                   /translation="MANHSQLGFQDASSPIMEELVEFHDHALMVALAICSLVLYLLTLM
FT                   LMEKLSSNTVDAQEVELIWTILPAIVLILLALPSLQILYMMDEIDEPDLTLKAIGHQWY
FT                   WSYEYTDFKDLTFDSYMIPTTELPPGHFRLLEVDHRVVIPMESPIRIIVTAGDVLHSWA
FT                   IPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVESTPLAHFESWS
FT                   SLLSS"
FT   tRNA            7777..7845
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:7805..7807,aa:Lys)"
FT   CDS             7847..8014
FT                   /transl_table=2
FT                   /gene="ATPase 8"
FT                   /product="ATPase subunit 8"
FT                   /db_xref="GOA:A0AB46"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB46"
FT                   /protein_id="CAJ86556.1"
FT                   /translation="MPQLNPNPWFFIMLLSWLTFTLIIQPKLLSFPPTNPPSNKTTAHT
FT                   KTTPWTWPWT"
FT   CDS             8005..8688
FT                   /transl_table=2
FT                   /gene="ATPase 6"
FT                   /product="ATPase subunit 6"
FT                   /db_xref="GOA:A0AB47"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB47"
FT                   /protein_id="CAJ86557.1"
FT                   /translation="MNLSFFDQFMSPHLLGIPLILLSTLFPALLLPTPGNRWITNRLST
FT                   LQSWSLHLIAKQLMTPLNKNGHKWALILTSLMTLLLMINLLGLLPYTFTPTTQLSMNMA
FT                   LAFPLWLATLLTGLRNQPSASLGHLLPEGTPTPLIPALIMIDTTSLLIRPLALGVRLTA
FT                   NLTAGDLLIQLISMATTALLSIMPAISILTTLILLLLTILEVAVAMIQAYVFVLLLSLY
FT                   LQENI"
FT   CDS             8688..9471
FT                   /transl_table=2
FT                   /transl_except=(pos:9471,aa:TERM)
FT                   /gene="COIII"
FT                   /product="cytochrome oxidase subunit III"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A0AB48"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB48"
FT                   /protein_id="CAJ86558.1"
FT                   /translation="MAHQAHSYHMVDPSPWPIFGAIAALLTTSGLVMWFHHNSSQLLTL
FT                   GLLSMILVMLQWWRDVIRESTFQGHHTPTVQKGLRYGMILFITSEAFFFLGFFWAFFHS
FT                   SLVPTPELGGQWPPTGIQPLNPMEVPLLNTAILLASGVTVTWAHHSITEGNRKHAIHAL
FT                   TLTILLGFYFTALQAMEYYEAPFSIADGVYGSTFFVATGFHGLHVIIGSSFLSICLLRL
FT                   IKYHFTSNHHFGFEAAAWYWHFVDVIWLFLYMTIYWWGS"
FT   tRNA            9472..9540
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:9500..9502,aa:Gly)"
FT   CDS             9541..9891
FT                   /transl_table=2
FT                   /gene="NADH3"
FT                   /product="NADH dehydrogenase subunit 3"
FT                   /db_xref="GOA:A0AB49"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB49"
FT                   /protein_id="CAJ86559.1"
FT                   /translation="MNMITFMLLLSLALSTILTTLNFWLAQITPDSEKLSPYECGFDPL
FT                   GSARLPFSIRFFLVAILFLLFALEIALLLPLPWATQLQSPTSTLTWASIIILLLTLGLV
FT                   YEWSQGGLEWAE"
FT   tRNA            9894..9962
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:9922..9924,aa:Arg)"
FT   CDS             9964..10260
FT                   /transl_table=2
FT                   /gene="NADH4L"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /db_xref="GOA:A0AB50"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB50"
FT                   /protein_id="CAJ86560.1"
FT                   /translation="MSFTHLSFYSAFTLSSLGLAFHRTHLISPLLCLESMMLSMYIILS
FT                   IWPAENQATTFTLMPILMLTFSACEAGTGLAMLVASTRTHGSDHLHTLNMLQC"
FT   CDS             10254..11621
FT                   /transl_table=2
FT                   /gene="NADH4"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /db_xref="GOA:A0AB51"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB51"
FT                   /protein_id="CAJ86561.1"
FT                   /translation="MLKIILPTIMLLPTALLSPPKFLWTNTPTRSLMIAALSLQWLLPT
FT                   YFPYKNLTQWTGIDQTSALLLVLSCWLLPLMIIASQNHLQHEPLSRKRTFIATLITIQP
FT                   FIILAFSTTELTLFYISFEATLIPTLILITRWGNQPERLSAGIYLLFYTLISSLPLLVT
FT                   ILYLNTQTGTLHLAMLELTPFTLTSSWTGLLSSLALLMAFMVKAPLYGFHLWLPKAHVE
FT                   APIAGSMLLAALLLKLGGYGIMRLTLLMGPLSTPLHYPFLTLSLWGALMTSSICLRQTD
FT                   LKSLIAYSSVSHMGLVIAAGMIQTHWSFSGAMILMISYGLTSSMLFCLANTNYERTHSR
FT                   ILLLARGLQPILPLMATWWLLANLTNMALPPTTNLMAELTIMVALFNWSNLTIILTGTA
FT                   TFLTASYTLFMLLSTQRGPLPTHITSLQNSNTREHLLMALHIIPLLLLILKPSLIS"
FT   tRNA            11633..11702
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:11662..11664,aa:His)"
FT   tRNA            11703..11767
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:11726..11728,aa:Ser)"
FT   tRNA            11768..11838
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:11798..11800,aa:Leu)"
FT   CDS             11839..13653
FT                   /transl_table=2
FT                   /gene="NADH5"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="GOA:A0AB52"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB52"
FT                   /protein_id="CAJ86562.1"
FT                   /translation="MDTTLLLNTFMLLTLTIILTPMLLPLLSNNLKNSPATITQAVKIA
FT                   FLTSLVPTTLFMYSGMENIISHWEWKFIMNFKIPLSFKMDQYSMMFLPIALFVTWSILQ
FT                   FATWYMASEPYISKFFSYLLTFLIAMLTLTIANNMFLLFIGWEGVGIMSFLLIGWWHGR
FT                   AEANTAALQAVLYNRIGDIGLILSMAWLASTMNTWEIHQTPSLTQTPTLPLLGLILAAT
FT                   GKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGIFLLIRTHPMLTNNQTALTICLCL
FT                   GALSTLFAATCALTQNDIKKIIAFSTSSQLGLMMVAIGLDLPQLAFLHISTHAFFKAML
FT                   FLCSGSIIHNLAGEQDIRKMGGLQKSLPITTSCLTIGNLALMGTPFLAGFYSKDLIIEN
FT                   LNTSYLNTWALLLTLLATTFTATYSLRMTLLVQTGSTRTSTISAMNENDPTITSPILRL
FT                   ALGSILAGLLITSYLPPTKTPPMTMPILTKTAAIIVTALGIILALELSNMTTTLTYPKP
FT                   NPYLNFSSTLGYFNPLTHRLSSTNLLNSGQKIASHLIDLSWYKKMGPEGLADMQLMATK
FT                   TSTTLHSGLIKTYLGSFALSILIALLLI"
FT   CDS             13665..14807
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A0AB53"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB53"
FT                   /protein_id="CAJ86563.1"
FT                   /translation="MAPNPRKSHPLLKMVNNSLIDLPTPPNISAWWNFGSLLGICLATQ
FT                   IITGLLLAMHYTADTTLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIYLHIGRGFY
FT                   YGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGQTLVE
FT                   WAWGGFSVDNPTLTRFFALHFLLPFLIAGLTLIHLTFLHESGSNNPLGVVSNCDKIPFH
FT                   PYFSTKDLLGFIIMLTPLLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAI
FT                   LRSIPNKLGGVLALAASVLILFLCPFLHKSKQRTMTFRPLSQILFWVLVANLLILTWVG
FT                   SQPVEHPFIIIGQLASLTYFTILLILFPLIGALENKMLNY"
FT   tRNA            14811..14879
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:14838..14840,aa:Thr)"
FT   tRNA            complement(14895..14963)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:14931..14933,aa:Pro)"
FT   CDS             complement(14973..15494)
FT                   /transl_table=2
FT                   /gene="NADH6"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /db_xref="GOA:A0AB54"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:A0AB54"
FT                   /protein_id="CAJ86564.1"
FT                   /translation="MTYFIVFLAVCFVLGGLAVASNPSPYYGVVGLVVASVVGCGWLVS
FT                   LGLSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVMGYGVGFALVLILGVVV
FT                   GGFVKGWEWGVVAVDSGGMLSVRLDFGGVAMFYSWGVGMFLMGGWGLLLTLFVVLELVR
FT                   GLSRGAIRAV"
FT   tRNA            complement(15497..15567)
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:15534..15536,aa:Glu)"
FT   misc_feature    15568..17037
FT                   /note="control region"
XX
SQ   Sequence 17037 BP; 5344 A; 5370 C; 2248 G; 4075 T; 0 other;
     gtccctgtag cttaacccaa agcatggcac tgaagatgcc aagacggttg cctcccatgc        60
     acccaaggac aaaagactta gtcctaacct taccgttaat tcttgctaaa catatacatg       120
     caagtatccg cgctccagtg taaatgccct cggtgcctta ctaagacccg aggagcgggc       180
     atcaggcaca cccacagtcg tagcccaaga cgccttgctc agccacgccc ccacgggtac       240
     tcagcagtaa ttaacattaa gcaataagtg taaacttgac ttagttatag caatccccag       300
     ggttggtcaa tcttgtgcca gccaccgcgg tcacacaaga aacccaaatt aaccgtaata       360
     cggcgtaaag cgtgacatta tgctatccct ctaactagga tcaaaataca actaagctgt       420
     cataagctca tgatgtaccc aaaatcaacc tgaaaacgat cccagcccca acgatctatt       480
     aaccgtcacg aaagctagaa tacaaactgg gattagatac cccactatgc ctagccctaa       540
     atcttgatac ttcccccaca caaagtattc gcccgagaac tacgagcaca aacgcttaaa       600
     actctaagga cttggcggtg ccccaaaccc acctagagga gcctgttctg taatcgataa       660
     cccacgatac acccgaccac tccttgccaa agcagcctac ataccgccgt cgccagttca       720
     cctcccctga gagagcaaca gtgaacataa tagtcctacc cgctaacaag acaggtcaag       780
     gtatagccta tggagtggaa gaaatgggct acattttcta gaatagaaaa ccacggaaag       840
     agatatgaaa tcacctctgg aaggcggatt tagcagtaaa gaaggataat aaagccacct       900
     ttaaactggc cctggggcac gtacataccg cccgtcaccc tcctcaaaag ctacaacacc       960
     caacatacct aatttcctaa ctagctaaag atgaggtaag tcgtaacaag gtaagtgtac      1020
     cggaaggtgt acttagcata ccaagacgta gctataacaa aagcattcag cttacacctg      1080
     aaagatatct gcaacaccac acagatcgtc ttgaagccca atacctagcc caaccaccat      1140
     aaactaaatc aaaccaaaaa aattcacttc cagactaaac taaaacattt ttgtagctta      1200
     gtataggcga tagaaaagct tgtatggcgc aatagcgaga ctcgtaccgt aagggaaagg      1260
     tgaaataaca atgaaaactt taagcaaaaa atagcaaaga tcaacccttg taccttttgc      1320
     atcatggttt agcaagaaca accaagcaaa acgaccttaa gcttgccccc ccgaaaccca      1380
     agcgagctac tagcaagcag ctacccctga gcgaacccgt ctctgttgca aaagagtggg      1440
     acgacttgtt agtagaggtg aaaagcctac cgagctgggt gatagctggt tgcctgtgaa      1500
     acgaatttaa gttcactctt aatccccctc cacggcatac aacctatacc tccatgtagt      1560
     agatcaagag ctatttaaag gaggtacagc tcctttaaaa aagaacacaa cctcccccag      1620
     cggataacca cctcacacat caccaacctg tgggccttaa agcagccacc aacaaagaat      1680
     gcgtcaaagc tccaatccaa aaaaatctaa aaacaatacg actccctcat ccataacagg      1740
     ctaacctatc acaataggag aattaatgct aaaacgagta accatagggt aacccctcta      1800
     aggcgtaact tacattattt attattaaca gacacccata atactacatc ctaacaagac      1860
     caagtattga cccttaccct gttaacccaa ctcaggagcg cctatcagaa agattaaaat      1920
     ctgtaaaagg aactaggcaa acaagagacc cgactgttta ccaaaaacat agccttcagc      1980
     tcaacaagta ttgaaggtga tgcctgccca gtgacactac gttcaacggc cgcggtatcc      2040
     taaccgtgca aaggtagcgc aatcaattgt ctcataaatc gagacttgta tgaatggcta      2100
     aacgaggcct caactgtctc ttacagataa tcagtgaact gatcttcctg tgcaaaagca      2160
     ggaataatta cataagacga gaagaccctg tggaacttaa aaatcagcag ccaccctgcc      2220
     aaactcaaac ctaccaggcc cactaaaccc ctacagcaaa cactggctcg cattttttgg      2280
     ttggggcgac cttggagaaa aatagaacct ccaaaaacaa gaccatacct cttatccaag      2340
     agcaacacct cgacgtacaa acagtaacca gacccagtac aactgagcaa tgaaccaagc      2400
     taccccaggg ataacagcgc aatctccccc aagagcccat atcgacaggg aggtttacga      2460
     cctcgatgtt ggatcaggac atcctaatgg tgcagccgct attaagggtt cgtttgttca      2520
     acgattaaca gtcctacgtg atctgagttc agaccggagc aatccaggtc ggtttctatc      2580
     tatgactaac tttccctagt acgaaaggac cgggaaagtg aggccaatac gacaagcacg      2640
     ccttccctat aagtaatgta cccaactaaa ttaccaaaag gacatccacc ccacaccact      2700
     gccctagaaa agggccgcta gcgtggcaga gctcggcaaa tgcaaaaggc ttaagccctt      2760
     tacccagagg ttcaagtcct ctccctagct tcccccacca tgaatcactc gcctctccta      2820
     acctatctaa ccatatccct ttcctatgct atcccaatct taatcgctgt agcttttctc      2880
     acactagtag aacgaaaagt cctaagttac atgcaagctc gcaaaggtcc aaacattgta      2940
     ggacccttcg gactcctaca acccgtagca gatggagtaa agctgtttat caaagaacca      3000
     gtacgcccct ctacatcctc tccactccta ttcatcataa cccctatact cgccctccta      3060
     ctagctatca caatctgaat tcccctgccc cttccatttc cccttacaga cctaaacctc      3120
     ggcctcctat tcctcctagc tatatcaagc ctagcagttt actcaatcct atgatcagga      3180
     tgagcctcaa actcaaaata tgccctaatc ggagcattac gagcagtagc acaaaccatc      3240
     tcctacgaag ttacactagc aatcatccta ctatcagtaa ttatactaag cggaaactat      3300
     accttaaata ctctagccac aacccaagaa cccctatacc taatcttctc ctcctggccc      3360
     ttagcaatga tatggtatat ctcaaccctt gctgaaacaa accgagcccc cttcgacctt      3420
     actgaagggg aatctgaatt agtatccgga ttcaatgtag aatacgctgc gggcccattc      3480
     gcattattct tcctagccga atacgccaac attatactaa taaacactct aaccgctatc      3540
     ctattcctaa atccaagctc cctcaactcc tccactgagc tatttccaat catcctcgcc      3600
     tcaaaaaccc tcctactttc ctcaggcttc ctatggatcc gcgcctcata ccctcgattc      3660
     cgttatgacc aactcataca cctactatga aaaaactttt taccactaac actagcactt      3720
     tgtctctgac acaccagcat gccaatctgc tatgcagccc ttcctcctca ttcaaggaaa      3780
     tgtgcctgaa tgttaaaggg tcactatgat aaagtgaaca tagaggtaca ccaaccctct      3840
     catttcctag taacctaaac cttagaaaag taggaattga acctacacaa aagagatcaa      3900
     aactcttcat acttccctta tattatttcc tagtagggtc agctaactaa agctatcggg      3960
     cccatacccc gaaaatgatg gtttaacccc ttcctctact atccctaatg aatccctacg      4020
     ccaaactaat tttcaccata agcctactct taggtacaac cataacaatc tccagcaacc      4080
     actgaataat agcctgaaca gggctagaaa tcaacaccct agccattatt cccctcatcg      4140
     caaaacacca ccacccacga gctatcgaag ctgcaatcaa atatttcctt acccaagcag      4200
     ccgcctcaac actactccta ttctcaagta caatcaatgc ttggtcctct ggacaatgag      4260
     acatcaccca attaaaccac cccatcgcat gtacactatt aacaacagca attgcaataa      4320
     aactcggatt agtcccattc cacttctgat ttccagaagt actccaagga tcttcactca      4380
     caactgcaat acttttatca acagtaatga agttcccccc aatcacgatc ctcttcataa      4440
     catccccctc actaaaccca accctcctct ccattatagc aatcgcctca actgccctgg      4500
     gaggttgaat aggactaaac caaacacaag tccgaaaaat cctagccttc tcatccattt      4560
     ctcacctcgg atgaatagcc ctcattctca tttacaaccc caaactaacc ttactaacat      4620
     tttacgtgta ttgcctaata actatcaccg tcttccttac tctaaataca acaaaaacac      4680
     tcaaactgtc cacaataata acctcctgaa caaaaacccc cacactaaat gcaaccctaa      4740
     taataaccct tctgtcctta gccggtctcc cacccctaac aggtttccta cccaaatgac      4800
     tcaccatcca agaactaacc aagcaagaaa taacctcagc agctacactc atcgcaattc      4860
     tttccctact aggactgttc ttttacctac gccttgcgta ctactcaaca attacactcc      4920
     cacccaaccc cacaaaccac ataaaacagt ggcacttcta caaaccaaca aacaccctca      4980
     tccccatcct tacctcactc tctgctcttc tcctccccct gtcccccata atcctcacca      5040
     ttacttagaa gcttaggata acctaaaccg gaggccttca aagcctcaaa taagagttaa      5100
     accctcttag tttctgctaa gacccgcagg acattaacct gcatctcctg aatgcaaccc      5160
     agatgcttta attaagctag gaccttccct agacgggtgg gcctcgatcc cacaatctcc      5220
     tagttaacag ctaggtgccc gaaaccagca ggcctccatc tacaagactc cggtacactc      5280
     tcaatgcaca tcaatgagct tgcaactcac catgaacttc actacagagt cgataagaag      5340
     aggaattaaa cctctgtgaa aaggactaca gcctaacgct ttaacattca gccatcttac      5400
     ctgtgaccta cattaaccga tgattattct caacaaacca caaagacatt ggcaccctat      5460
     acctaatctt tggagcatga gccggcatag tcggaactgc cctcagccta cttatccgag      5520
     cagaacttgg gcaaccagga actctcctag gagatgacca aatctacaac gtcattgtaa      5580
     ctgctcacgc tttcgtcata atcttcttca tagtcatgcc tatcataatc ggaggatttg      5640
     gaaactgact agtacccctc ataatcggtg cacccgacat agcattcccc cgaataaaca      5700
     acataagctt ctgattactt cctccatcat tcctactcct cctagcctcc tcaacagtag      5760
     aagcaggagc aggaacaggc tgaaccgtat accctcccct agcaggtaac ttagctcacg      5820
     caggagcatc agtagacctc gccatcttct ccctccacct agcaggtgtc tcctccatcc      5880
     taggtgcaat taacttcatc accaccgcta tcaacataaa accccctgcc ctttcacaat      5940
     atcaaacacc cctattcgta tgatccgtcc tcatcaccgc cgtcctacta ctcctctccc      6000
     tccccgttct tgccgccggc attactatac tcttaactga ccgcaaccta aacaccacat      6060
     tcttcgaccc agctggagga ggagacccaa tcctatacca acacctattc tgattctttg      6120
     gccacccgga ggtctacatc ctaatcctac ccggcttcgg aatcatctca catgtagtag      6180
     catactacgc gggtaaaaaa gaaccattcg gctacatagg catagtatga gccatgttat      6240
     caatcggatt cctaggcttc atcgtatgag cccaccacat atttaccgta ggaatagacg      6300
     tagacactcg agcctacttt acatccgcca ccataatcat tgccattcct atcggaatca      6360
     aagtcttcag ctgactagca accttacacg gtgggacaat taaatgagac ccacctatgc      6420
     tatgagccct aggctttatc ttcctattta ctattggagg cctaaccggc atcattctag      6480
     caaactcctc cctagacatt gccctacacg atacatacta cgtagtagca cacttccact      6540
     acgtactctc gatgggagcc gtctttgcca ttctagccgg attcactcac tgattccccc      6600
     tattcacagg ctacaccctc caccaaacat gatccaaagc tcacttcgga gtcatatttg      6660
     caggagtcaa cttaaccttc ttccctcagc acttcctagg ccttgccgga ataccacgcc      6720
     gatactcaga ctatcctgat gcctataccc tatgaaacac cctatcctcc atcggctccc      6780
     taatctcaat gaccgccgtt atcatactaa tattcatcat ctgagaagca ttcgcatcta      6840
     aacgtaaagt tctacaacca gaacttaccg ctacaaacat cgaatgaatc cacggctgcc      6900
     cacctccata ccacacattc gaagaacccg ctttcgtaca aatccaagaa aggaaggaat      6960
     cgaaccctca tatgatggtt tcaagccaac cgcattacac cacttatgct tctttcttat      7020
     gaggtgttag taaactaatt acatagcctt gtcaagacta aatcacgagt gaaaaccccg      7080
     tacatctcac tatggccaac cactcacaac tcgggttcca agacgcatca tccccaatca      7140
     tagaagaatt agtagaattc cacgaccatg ccctaatagt cgcgctagca atctgtagct      7200
     tagttcttta cctacttact ctcatattaa tagaaaaact atcctcaaac accgtagatg      7260
     cacaagaagt agaactcatc tgaacaatcc taccagccat cgtcctcatc ctccttgcgc      7320
     tcccatccct acaaatcctt tacataatag acgaaatcga tgaacccgac ctaactctaa      7380
     aagccatcgg acatcaatga tactgatcat acgaatacac agacttcaaa gatcttacat      7440
     tcgactcata cataatcccc accacagaac taccaccagg ccacttccga ctactagaag      7500
     tcgaccaccg cgttgtcatt cccatagaat ccccaatccg tatcatcgtc actgcaggag      7560
     acgtcctaca ctcctgggca atccccactc tgggagtaaa aaccgacgcc attccaggtc      7620
     gactaaacca aacatcattt atcactaccc gaccaggaat cttctacggt caatgctcag      7680
     aaatctgcgg agctaaccac agctacatac ctattgtagt agaatctacc ccccttgccc      7740
     acttcgagag ctgatcctca ttattatcat cctaatcatt aggaagctat gcaacagcgc      7800
     tagcctttta agctagaaag agaggttcat ccacctccct aatgacatgc cacaactcaa      7860
     ccctaaccca tgattcttca ttatactact atcatgactt accttcacac taatcattca      7920
     acctaaactc ctatcattcc cccccactaa ccccccttca aacaaaacca cagcccacac      7980
     caaaaccacc ccctgaacct gaccatgaac ctaagcttct tcgatcaatt cataagccct      8040
     catctactag gaatcccact aatcctcctc tctacattat tcccagccct cctcctcccc      8100
     acaccaggaa accgatgaat tactaaccga ctttccacct tacaatcatg atcccttcac      8160
     ctaattgcaa aacaacttat aactccacta aacaaaaacg gccataaatg agcccttatc      8220
     ctaacatcac taatgacact cctcctcata attaacctcc taggcttact accttacaca      8280
     ttcaccccaa ctacccaact atctataaac atagccctcg ccttcccact ctgactcgct      8340
     accctcctga caggcctacg aaaccaaccc tctgcttccc taggacacct tctccccgaa      8400
     gggacgccaa ccccacttat cccagcccta atcatgatcg ataccactag cctcttaatt      8460
     cgaccactag cattaggggt ccgcctcaca gcaaatctca cagcaggcga cctattaatc      8520
     caactcatct ctatagccac caccgcccta ctctcaatca taccagccat ctcaatccta      8580
     actacactaa tcctactcct actaacaatc ctagaagtag ctgtagctat aatccaagcc      8640
     tacgtcttcg tcctccttct aagcctctac ttacaagaaa acatctaatg gcccaccaag      8700
     cacactcata ccacatagta gatccaagcc cttgacccat cttcggagca atcgctgcct      8760
     tacttactac ctccggacta gtcatatgat ttcaccacaa ttcttcccaa ctccttacct      8820
     taggcctact ctccataatc ctagttatac tacaatgatg acgtgacgtc atccgagaaa      8880
     gcacattcca aggccaccac accccaaccg tccaaaaagg cctgcgatat ggaatgatcc      8940
     tattcattac atcagaagca ttcttcttcc tagggttctt ctgagcattc ttccactcca      9000
     gcctagtccc taccccagaa ctagggggac aatgaccccc aacaggaatc caacccctaa      9060
     accctataga agttcctcta ctaaacacag ccatcctcct agcctcagga gttaccgtta      9120
     catgagccca ccacagcatc acagaaggca atcgaaaaca tgccatccat gcactaaccc      9180
     taacaatcct actaggattc tacttcactg cactacaagc aatagaatac tacgaagcac      9240
     cattctcaat cgccgacggg gtctatggct caaccttctt cgtagcaaca ggatttcacg      9300
     gactccatgt aatcattggg tcttccttcc tatcaatttg cctcctacgc ctaatcaaat      9360
     atcacttcac atcaaaccat cacttcggat ttgaagccgc agcctgatat tgacacttcg      9420
     tagacgtcat ctgattattc ctctatataa ccatttactg atgaggatcc tgctcttcta      9480
     gtatacttaa tacaattgac ttccactctc tagaatctgg ttcaacccca gagaagagca      9540
     ataaacataa tcacgttcat actcctccta tcccttgccc taagcactat cttaactaca      9600
     ttaaactttt gacttgccca aatcactcca gactcagaaa aactatcccc ctacgaatgt      9660
     ggattcgacc cactaggctc cgctcgcctt ccattctcaa tccgattctt cctagtagcc      9720
     atcctattcc tgctattcgc cctagaaatc gcactcctac tcccacttcc ctgagccaca      9780
     caacttcaat ctcctacatc caccttaact tgagcctcta tcattatcct cttactcaca      9840
     ctaggacttg tctacgaatg atctcaagga ggcctagaat gagcagaata aacagaaagt      9900
     tagtctaact aagacaactg atttcgactc agtagaccat agcctgtcac tatgactttc      9960
     tttatgtcat tcacacattt aagcttctac tcagccttca ctctaagcag cctaggatta     10020
     gccttccacc gaacccatct aatctctccc ctcctatgtt tagaaagtat aatattatcc     10080
     atatatatca tcctatcaat ctgacccgcc gaaaaccaag caactacctt caccctaata     10140
     ccaatcctca tactaacatt ctctgcctgc gaggctggca caggcttagc aatactagta     10200
     gcctccacac gaactcacgg ctcagaccac ctacacaccc taaacatact acaatgctaa     10260
     aaatcattct accaacaatt atgctcctac caaccgccct cctatccccc ccgaaattcc     10320
     tatgaactaa caccccaaca cgcagcctaa taattgcagc ccttagcctc caatgattac     10380
     tccccacata cttcccctac aaaaatctaa cccaatgaac tggcattgat caaacctccg     10440
     ctctactact agttctatca tgctgactcc taccccttat aatcattgca agtcaaaacc     10500
     acttacagca cgagccactc tctcgaaaac gaaccttcat cgcaacccta atcactatcc     10560
     aaccattcat catcttagcc ttctcaacca cagagctaac actattttat atctcattcg     10620
     aagccaccct aatccccaca ctaatcctaa tcacacggtg aggaaaccaa ccagaacgcc     10680
     taagtgctgg catttaccta ctattctaca cactcattag ttcccttccc cttttagtta     10740
     ctatcctata tctcaacaca caaacaggta ctctccacct agcaatacta gaactaaccc     10800
     ccttcacact aaccagctcc tgaactggtc tcctatctag cctagcccta ttaatagcat     10860
     ttatagtcaa agccccccta tatggattcc acctatgatt acccaaagcc catgtagaag     10920
     cccccattgc aggatccata ttacttgccg ccctactcct caaactcggc ggatacggca     10980
     tcatacgcct caccctccta ataggtcccc tctctacccc cctgcactat ccattcctaa     11040
     cattaagctt atgaggggca ctaataacca gctcaatctg cctacgacaa acagacctaa     11100
     aatcactcat cgcatactca tccgtaagcc acataggact agtcatcgcc gcaggtataa     11160
     tccaaacaca ttgatcattc tcaggtgcaa taatcctcat aatctcctac ggcctcacct     11220
     cctctatact cttctgccta gcaaacacaa actacgaacg aacccacagc cgaatcctcc     11280
     tcctagctcg aggcttacag cctattctac cactcatagc aacctgatga ctactagcca     11340
     acctaacaaa catagcacta ccaccaacaa ccaacctaat agccgaacta accatcatag     11400
     tcgcactatt caattgatcc aacctcacaa tcatcttaac cggaacagca acctttctaa     11460
     ccgcctcata caccttattc atattattat ccacccaacg aggcccactc cccacccaca     11520
     tcacatcact ccaaaactca aacacccgag aacatctact aatagctctc cacattatcc     11580
     ccctactact cctcatcctt aaacccagcc tcatctcaag atactcccct atgcacgtat     11640
     agtttcaacc aaaacattag actgtgatcc taaaaataga agttaaaccc ttcttacctg     11700
     ccgaggggag gtaacccacc aagaactgct aactcttgca tctgagttta aaacctcagt     11760
     ccccttaact tttaaaggat aacagcaatc cactggtctt aggaaccact catcttggtg     11820
     caaatccaag taaaagtaat ggataccaca ctactcctca acacattcat actcctaaca     11880
     ctaacaatta tcctaacccc aatactcctt cccctactat caaacaacct aaaaaactcc     11940
     cctgccacta tcacacaagc cgtcaaaatc gctttcctaa caagcctcgt accaacaaca     12000
     ctattcatgt actcaggcat agagaacatc atctcccact gagaatgaaa atttatcata     12060
     aacttcaaaa tccccctgag ctttaaaata gatcagtact caataatatt cctccctatc     12120
     gcactatttg ttacatgatc catcctccaa tttgcaacat gatacatagc ctcagaaccg     12180
     tacatttcaa aattcttctc atacctactt accttcctaa tcgctatatt aaccctaacc     12240
     attgccaaca acatatttct attattcatt ggctgagaag gcgtagggat catatccttc     12300
     ctcctcattg gctgatgaca tggacgagca gaagccaaca cagccgccct tcaagccgta     12360
     ctctacaatc gaatcggaga cattggcctc atcctcagca tagcatgact cgcctcaacc     12420
     ataaacacct gagaaatcca ccaaaccccc tccttaacac aaacccctac actaccccta     12480
     ctaggactaa ttttagcagc caccggaaaa tcagcccaat ttggcctcca cccctgactc     12540
     cccgctgcca tagaaggccc aacccccgtc tccgccctac tccactctag cacaatagta     12600
     gtcgccggaa tcttcctact tatccgcact cacccaatat taaccaacaa tcaaaccgcc     12660
     ctcaccatct gtctatgcct aggcgcccta tctacattat tcgccgctac ctgcgccctc     12720
     acacaaaatg atatcaaaaa aatcatcgcc ttctccacat caagccaact aggactaata     12780
     atagtcgcca ttggcctaga ccttccacaa ctagcatttc tccacatttc aacccatgct     12840
     ttcttcaaag ccatactatt cttatgctcc ggatcaatca tccacaatct tgccggagaa     12900
     caagacatcc gaaaaatagg aggcctacaa aaatcactcc ccattaccac ttcttgctta     12960
     actatcggca acctcgcact aatgggcact cccttcctgg caggattcta ctcaaaagat     13020
     ctcatcatcg aaaaccttaa cacatcctac ctaaacacct gagccctcct ccttacactc     13080
     ctagccacaa cattcaccgc aacctacagt ctccgaataa ctctactagt acaaacaggc     13140
     tccacccgca catccacaat ctccgcaata aacgaaaacg accccacaat tacctccccc     13200
     atccttcgtc tagccctagg tagcatcctc gctggcctcc taatcacatc ctacctccca     13260
     cccacaaaaa ctccaccaat aaccatacca atcttaacaa aaaccgctgc cattatcgtc     13320
     acagccctag gcattatcct cgctctcgaa ctatcaaaca taaccaccac cctaacctac     13380
     ccaaaaccaa acccctacct aaacttctca tcaacattag ggtacttcaa tcccctaacc     13440
     caccgcctta gctctactaa cctactaaat agcggacaaa aaatcgcctc acacctaatc     13500
     gacctatcat gatataaaaa aataggccca gaaggactcg ctgacataca actcatagca     13560
     accaaaacct caaccaccct ccactcagga ctaatcaaaa cctacctagg ttccttcgcc     13620
     ttatcaatcc ttatcgccct actactaatt taaacaacac accaatggcc cccaacccac     13680
     gaaaatccca cccactccta aaaatagtca acaactccct aatcgacctc cccactcccc     13740
     caaacatttc cgcctgatga aacttcggat ccctcctagg tatctgccta gcaacacaaa     13800
     tcatcaccgg ccttctacta gctatacact atactgcaga cacaacctta gccttctcat     13860
     cagtagctca cacatgccga aacgtccaat atggatgact aattcgtaac ctacatgcaa     13920
     acggagcctc attcttcttc atctgcatct acctccatat cggacgagga ttctactatg     13980
     gatcttacct ctacaaagaa acctgaaaca caggagtaat cctactacta accctcatag     14040
     caactgcctt cgtaggctac gtcctcccct gaggacaaat atcattctga ggtgcaacag     14100
     tcattaccaa cctcttctca gcaatcccat acatcggcca aaccctcgta gaatgagcct     14160
     gagggggatt ctcagtagac aaccccacat taacccgatt ctttgcccta cacttcctcc     14220
     tcccctttct aatcgcaggc ctcaccctta tccacctcac tttcctccat gaatcaggat     14280
     ctaacaaccc cctaggagtt gtatcaaact gtgacaaaat cccattccac ccctacttct     14340
     ccacaaaaga ccttctggga tttatcatca tactcactcc actcctaacc ctagccctat     14400
     tctcccctaa cctcttaggg gaccccgaaa acttcacccc agccaaccca ctagtaactc     14460
     ctcctcatat caaaccagaa tgatactttc tatttgcata cgctatccta cgctcaatcc     14520
     ctaacaaact tggaggagta ctagcccttg ctgcctccgt actaattcta ttcctatgtc     14580
     cattcctcca caaatccaaa caacgcacaa taacattccg ccccctatca caaatcctat     14640
     tttgagtcct tgtagctaac ctacttatcc taacctgagt aggtagccaa ccagtagaac     14700
     acccattcat catcatcggc caactagcct ccctcaccta cttcactatt ctcctaatcc     14760
     tcttccccct tatcggagct ctagaaaaca aaatacttaa ctactaaaat actctaatag     14820
     tttattaaaa cattggtctt gtaagccaaa gaatgaagac tccacccctt cttagagtta     14880
     ccccaaccca aatatcagaa aaaaaggact taaacctcta tctccaactc ccaaagctgg     14940
     cattttcatt aaactattct ctgacacccc cccctaactg cccgaattgc accacgagaa     15000
     agtccccgca caagctccaa tacaacaaac agagtcaaca gtaaacccca cccacccatc     15060
     aaaaacatcc ccacccccca agaatagaac atagccacac caccaaaatc caaccgaaca     15120
     gaaagcatcc ccccactatc aactgctacc acccctcact cccacccctt aacaaagcca     15180
     cccaccacta cccccaaaat cagcactaaa gcaaacccaa ccccataccc tataacacgc     15240
     caatctcccc atgcctcagg aaaaggatca gctgccaacg acacagagta cacaaaaacc     15300
     actaacatcc cccccaaata caccataaac aaaaccaacg acacaaaaga aaggccaaga     15360
     cttaccaatc acccacatcc aacaacagaa gcaactacca aaccaaccac cccataatat     15420
     ggtgaaggat tagatgcaac tgctaatccc cctaacacaa aacacaccgc taaaaaaaca     15480
     atgaaatagg tcataaaggt tcctacttgg cttttctcca agacctacgg cctgaaaagc     15540
     cgtcgttgtt acttcaacca tagaaacaca gtctacacaa acaccattag ccctatgacg     15600
     tatgcccccc taccccccat aatacaggga tgttcctaga atcattatga gttctattgg     15660
     ctttatgtca tactagcatt catctatata ccccattaca ttaaatgata cctaggacat     15720
     acaccttaat acccgtacta aaaccataaa ctgttaacca gggcaggcaa aaacactcta     15780
     cgaatatgac accacagggg attaagaatg taatgttcta ccaccatacc ctaaaatcct     15840
     cgtactaaaa ccattagaac tctcggttat gcataaacct attaccccta cgagagagaa     15900
     tctcaggtac caaagaaatc catgttaggt agactgaacc tgccaccatt tcttgaagtg     15960
     ccggtagctg tcgtattggg ttatttattg atcgtacctc tcacgcgaga cagctacgca     16020
     ccgtagttcc taattacgtg accagcttca ggcccattta ctgcccctat agcttaatta     16080
     tacacaccgg tgagccttgc tcttttgcgc ctcgggctgt ttcttcatga gcatagtatg     16140
     gctcctccct ttccttttct cttcacgaga cctttggttc gttatattcg ttcttctcac     16200
     ccgtaatcgc ggcatctgta ttgctttttc acttttggtt ctttttctgg gggctgcttc     16260
     acaggtggcc cctccagtgc ggggaggtgc aaacattcaa gacatgaaca tcttatgaca     16320
     tgcgtcctgt tttttggcct tcaggagtag ctgaatgaga cggtttgcgt ataacgggaa     16380
     tcattttgac actgatgcac ttgctaccgc atttggttat ggagtatcca ctaactactt     16440
     atatatgttg ctttttagtt catgcttgtt agacataatt ttccagctat tttacattcc     16500
     tctaaattcc cttaatactg caaatcgaca ccagtaactt ttctactaat cttcccaaac     16560
     acaccatcat cataattttt tcattttttc aatttttttc atcacaccat cacttaacat     16620
     taccactgaa attacattaa taatctaatt aacatttttc aacatttatc atgttaattt     16680
     tttcataaaa acaccataat ttactaaagc aaccctacta gaacaaattt atacatcatc     16740
     catcatatca atcaacaaca aacactaata acaaacacta ataacaaaca ctaataacaa     16800
     acactaataa caaacactaa taacaaacac taataacaaa cactaataac aaacactaat     16860
     aacaaacact aataacaaac actaataaca aacactaata acaaacacta ataacaaaca     16920
     ctaataacaa acactaataa caaacactaa taacaaacac taataacaaa cactaataac     16980
     aaacactaat aacaaacact aataacaaac actaataaca aacactaata acaaaca        17037
//


spacer
spacer