spacer

EBI Dbfetch

ID   AM237285; SV 2; linear; mRNA; STD; HUM; 895 BP.
XX
AC   AM237285;
XX
DT   28-MAR-2006 (Rel. 87, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial mRNA for MHC class I antigen (HLA-C gene),
DE   HLA-Cw*07x05 hybrid allele
XX
KW   HLA-C gene; HLA-Cw*07x05 hybrid allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Dormoy A.;
RT   ;
RL   Submitted (27-MAR-2006) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000 Strasbourg, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B., Froelich N.;
RT   "The HLA-Cw*07x05 new allele is an hybrid allele between the Cw*0702 (exons
RT   1 and 2) and the Cw*0501 (exons 3 and 4)";
RL   Unpublished.
XX
RN   [3]
RP   1-895
RA   Dormoy A.;
RT   ;
RL   Submitted (05-JUL-2006) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000 Strasbourg, FRANCE.
XX
DR   MD5; 7ef12060c0ee531b16b6261994ef0405.
DR   H-InvDB; HIT000331661_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /PCR_primers="fwd_seq: ctgctgctctcgggaggc, rev_seq:
FT                   ccctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>895
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07x05 hybrid"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1XDY2"
FT                   /db_xref="H-InvDB:HIT000331661_02.4"
FT                   /db_xref="IMGT/HLA:C*07:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1XDY2"
FT                   /protein_id="CAJ86551.2"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
XX
SQ   Sequence 895 BP; 180 A; 280 C; 311 G; 124 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg acgggtctca caccctccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aatgaggacc tgcgctcctg gaccgccgcg       480
     gacaaggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     aagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccagagcccc tcaccctgag atggg            895
//


spacer
spacer