spacer

EBI Dbfetch

ID   AM236591; SV 1; linear; genomic DNA; STD; HUM; 3393 BP.
XX
AC   AM236591;
XX
DT   20-APR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*4446 allele
XX
KW   HLA-B gene; HLA-B*4446 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3393
RA   Cox S.;
RT   ;
RL   Submitted (20-MAR-2006) to the INSDC.
RL   Cox S., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.;
RT   "Sequence of HLA-B*4446";
RL   Unpublished.
XX
DR   MD5; 85b022fd704769f4a573d76aa53ba550.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3393
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,504..773,1017..1292,1868..2143,2237..2353,
FT                   2795..2827,2934..2977)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1RPB8"
FT                   /db_xref="IMGT/HLA:B*44:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1RPB8"
FT                   /protein_id="CAJ85743.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=1
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=2
FT   intron          774..1016
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=2
FT   exon            1017..1292
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=3
FT   intron          1293..1867
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=3
FT   exon            1868..2143
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=4
FT   intron          2144..2236
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=4
FT   exon            2237..2353
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=5
FT   intron          2354..2794
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=5
FT   exon            2795..2827
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=6
FT   intron          2828..2933
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=6
FT   exon            2934..2977
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4446"
FT                   /number=7
XX
SQ   Sequence 3393 BP; 628 A; 978 C; 1079 G; 708 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccctcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gccggtgagt gcggggtcgg gagggaaatg gcctctgtgg ggaggagaga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc       540
     ccggcccggc cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt       600
     cgtgaggttc gacagcgacg ccacgagtcc gaggaaggag ccgcgggcgc catggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac       720
     ttaccgagag agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcccccgag gccgcgggac ccgcccagac cctcgaccgg       900
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       960
     ttggtcgggg cggggcgggg ctcgggggac ggggctgacc gcggggccgg ggccagggtc      1020
     tcacatcatc cagaggatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg      1080
     gtatgaccag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc      1140
     ctggaccgcg gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt      1200
     ggcggagcag ctgagagcct acctggaggg cctgtgcgtg gagtcgctcc gcagatacct      1260
     ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc      1320
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1380
     ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1440
     ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat ggaggggaag      1500
     acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1560
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1620
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1680
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1740
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1800
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1860
     ccatcagacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggtcacc      1920
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1980
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc      2040
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      2100
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      2160
     gggtcatatc tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct      2220
     tcccttcctt tcccagagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct      2280
     ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg      2340
     aggaagagct caggtaggga aggggtgagg ggtggggtct gggttttctt gtcccactgg      2400
     gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatccacac      2460
     aggggctaac gcagcctggg accctgtgtg ccagcactta ctcttttgtg cagcacatgt      2520
     gacaatgaag gacggatgta tcaccttggt ggttgtggtg ttggggtcct gattccagca      2580
     ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg      2640
     acccacactt gctttcctcg tgtttcctga tcctgccttg ggtctgtagt catacttctg      2700
     gaaattcctt ttgggtccaa gacgaggagg ttcctctaag atctcatggc cctgcttcct      2760
     cccagtcccc tcacagggca ttttcttccc acaggtggaa aaggagggag ctactctcag      2820
     gctgcgtgta agtgatgggg gcgggagtgt ggaggagctc acccacccca taattcctcc      2880
     tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc caggcagcga      2940
     cagtgcccag ggctctgatg tgtctctcac agcttgaaaa ggtgagattc ttggggtcta      3000
     gagtgggtgg ggtggcaggt ctgggggtgg gtggggcagt ggggaaaggc ctgggtaatg      3060
     gagattcttt gattgggatg tttcgcgtgt gtggtgggct gtttagagtg tcatcactta      3120
     ccatgactaa ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt      3180
     gtgagggact gagatgcagg atttcttcac gcctcccctt tgtgacttca agagcctctg      3240
     gcatctcttt ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga      3300
     ggtggagaga cagcccaccc ccgtgtccac cgtgacccct gttcgcatgc tgacctgtgt      3360
     ttcctcccca gaagcttgcg gaagggcgaa ttc                                   3393
//


spacer
spacer