spacer

EBI Dbfetch

ID   AM235886; SV 1; linear; genomic DNA; STD; HUM; 3506 BP.
XX
AC   AM235886;
XX
DT   04-JUN-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*6802new allele
XX
KW   HLA-A gene; HLA-A*6802new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3506
RA   Poli F.;
RT   ;
RL   Submitted (09-MAR-2006) to the INSDC.
RL   Poli F., Dipartimento di Medicina Rigenerativa, Fondazione IRCCS Ospedale
RL   Maggiore Policlinico Via Francesco Sforza, 35 20122, Milano, ITALY.
XX
RN   [2]
RX   DOI; 10.1016/j.humimm.2006.11.007.
RX   PUBMED; 17349876.
RA   Longhi E., Frison S., Andreini E., Haworth S., Malagoli A., Carella G.,
RA   Crespiatico L., Poli F., Scalamogna M.;
RT   "Complete sequencing of the HLA-A*68020102 novel allele identified in two
RT   Caucasoid families";
RL   Hum. Immunol. 68(3):206-210(2007).
XX
DR   MD5; 00fd36e8b22143b0adfbe025e2d5d2b4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3506
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(290..362,493..762,1004..1279,1880..2155,2255..2371,
FT                   2810..2842,2985..3032,3202..3206)
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT   CDS             join(290..362,493..762,1004..1279,1880..2155,2255..2371,
FT                   2810..2842,2985..3032,3202..3206)
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1ELT0"
FT                   /db_xref="IMGT/HLA:A*68:02:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ELT0"
FT                   /protein_id="CAJ84550.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            290..362
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=1
FT   intron          363..492
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=1
FT   exon            493..762
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=2
FT   intron          763..1003
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=2
FT   exon            1004..1279
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=3
FT   intron          1280..1879
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=3
FT   exon            1880..2155
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=4
FT   intron          2156..2254
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=4
FT   exon            2255..2371
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=5
FT   intron          2372..2809
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=5
FT   exon            2810..2842
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=6
FT   intron          2843..2984
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=6
FT   exon            2985..3032
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=7
FT   intron          3033..3201
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=7
FT   exon            3202..3206
FT                   /gene="HLA-A"
FT                   /allele="A*6802new"
FT                   /number=8
XX
SQ   Sequence 3506 BP; 672 A; 1017 C; 1062 G; 755 T; 0 other;
     caggagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctatgtag ggtccttctt cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgcggttc taaagtccgc acgcacccac cgggactcag attctcccga tggccgtcat       300
     ggcgccccga accctcgtcc tgctactctc gggggccctg gccctgaccc agacctgggc       360
     gggtgagtgc ggggtcggga gggaaacggc ctctgtgggg agaagcaagg ggcccgcccg       420
     gcgggggcgc aggacccggg aagccgcgcc tggaggaggg tcgggcgggt ctcagccact       480
     cctcgccccc aggctcccac tccatgaggt atttctacac ctccatgtcc cggcccggcc       540
     gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc gtgcggttcg       600
     acagcgacgc cgcgagccag aggatggagc cgcgggcgcc gtggatagag caggaggggc       660
     cggagtattg ggaccggaac acacggaatg tgaaggccca gtcacagact gaccgagtgg       720
     acctggggac cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       780
     gggcgcaggt cacgacccct catcccccac ggacgggcca ggtcgcccac agtctccggg       840
     tccgagatcc gccccgaagc cgcgggaccc cgagaccctt gccccgggag aggcccaggc       900
     gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg gtcggggcgg       960
     ggcggggctc gggggaccgg gctgacctcg gggtccgggc caggttctca caccatccag      1020
     aggatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccaccagtac      1080
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg      1140
     gacatggcag ctcagaccac caagcacaag tgggaggcgg cccatgtggc ggagcagtgg      1200
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag      1260
     gagacgctgc agcgcacggg taccaggggc cacggggcgc ctccctgatc gcctgtagat      1320
     ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta gaatatcgcc      1380
     ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt accagagagt      1440
     gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc tgaaggaatg      1500
     acgggaagac gatccctcga atactgatga gtggttccct ttgacacaca caggcagcag      1560
     ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc aatgtgtgtg      1620
     ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg accagaagtc      1680
     gctgttccct cttcagggac tagaattttc cacggaatag gagattatcc caggtgcctg      1740
     tgtccaggct ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc ctgtccattc      1800
     tcaagatagc cacatgtgtg ctggaggagt gtcccatgac agatgcaaaa tgcctgaatg      1860
     atctgactct tcctgacaga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac      1920
     catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc      1980
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      2040
     ggggatggaa ccttccagaa gtgggtggct gtggtggtgc cttctggaca ggagcagaga      2100
     tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atggggtaag      2160
     gagggagacg ggggtgtcat gtcttttagg gaaagcagga gcctctctga cctttagcag      2220
     ggtcagggcc cctcaccttc ccctcttttc ccagagccgt cttcccagcc caccatcccc      2280
     atcgtgggca tcattgctgg cctggttctc tttggagctg tgatcactgg agctgtggtc      2340
     gctgctgtga tgtggaggag gaagagctca ggtggggaag gggtgaaggg tgggtctgag      2400
     atttcttgtc tcactgaggg ttccaagacc caggtagaag tgtgccctgc ctcgttactg      2460
     ggaagcacca cccacaatta tgggcctacc cagcctgggc cctgtgtgcc agcacttact      2520
     cttttgtaaa gcacctgtta aaatgaagga cagatttatc accttgatta cagcggtgat      2580
     gggacctgat cccagcagtc acaagtcaca ggggaaggtc cctgaggacc ttcaggaggg      2640
     cggttggtcc aggacccaca cctgctttct tcatgtttcc tgatcccgcc ctgggtctgc      2700
     agtcacacat ttctggaaac ttctctgagg tccaagactt ggaggttcct ctaggacctt      2760
     aaggccctga ctcctttctg gtatctcaca ggacattttc ttcccacaga tagaaaagga      2820
     gggagctact ctcaggctgc aagtaagtat gaaggaggct gatgcctgag gtccttggga      2880
     tattgtgttt gggagcccat gggggagctc acccacccca caattcctcc tctagccaca      2940
     tcttctgtgg gatctgacca ggttctgttt ttgttctacc ccaggcagtg acagtgccca      3000
     gggctctgat gtgtctctca cagcttgtaa aggtgagagc ctggagggcc tgatgtgtgt      3060
     tgggtgttgg gcggaacagt ggacacagct gtgctatggg gtttctttcc attggatgta      3120
     ttgagcatgc gatgggctgt ttaaagtgtg acccctcact gtgacagata cgaatttgtt      3180
     catgaatatt tttttctata gtgtgagaca gctgccttgt gtgggactga gaggcaagag      3240
     ttgttcctgc ccttcccttt gtgacttgaa gaaccctgac tttgtttctg caaaggcacc      3300
     tgcatgtgtc tgtgttcgtg taggcataat gtgaggaggt ggggagacca ccccaccccc      3360
     atgtccacca tgaccctctt cccacgctga cctgtgctcc ctccccaatc atctttcctg      3420
     ttccagagag gtggggctga ggtgtctcca tctctgtctc aacttcatgg tgcactgagc      3480
     tgtaacttct tccttcccta ttaaaa                                           3506
//


spacer
spacer