Dbfetch

ID   AM235885; SV 1; linear; genomic DNA; STD; HUM; 3517 BP.
XX
AC   AM235885;
XX
DT   04-JUN-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*6802 allele
XX
KW   HLA-A gene; HLA-A*6802 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3517
RA   Poli F.;
RT   ;
RL   Submitted (03-MAR-2006) to the INSDC.
RL   Poli F., Dipartimento di Medicina Rigenerativa, Fondazione IRCCS Ospedale
RL   Maggiore Policlinico Via Francesco Sforza, 35 20122, Milano, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Sequencing of HLA-A*6802 and of the new HLA-A*68 variant";
RL   Unpublished.
XX
DR   MD5; 21b71bd572d6dda388a4d60211edba0f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3517
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(301..373,504..773,1015..1290,1891..2166,2266..2382,
FT                   2821..2853,2996..3043,3213..3217)
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT   CDS             join(301..373,504..773,1015..1290,1891..2166,2266..2382,
FT                   2821..2853,2996..3043,3213..3217)
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1ELT0"
FT                   /db_xref="IMGT/HLA:A*68:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ELT0"
FT                   /protein_id="CAJ84549.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            301..373
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=1
FT   intron          374..503
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=2
FT   intron          774..1014
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=2
FT   exon            1015..1290
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=3
FT   intron          1291..1890
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=3
FT   exon            1891..2166
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=4
FT   intron          2167..2265
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=4
FT   exon            2266..2382
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=5
FT   intron          2383..2820
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=5
FT   exon            2821..2853
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=6
FT   intron          2854..2995
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=6
FT   exon            2996..3043
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=7
FT   intron          3044..3212
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=7
FT   exon            3213..3217
FT                   /gene="HLA-A"
FT                   /allele="A*6802"
FT                   /number=8
XX
SQ   Sequence 3517 BP; 675 A; 1021 C; 1066 G; 755 T; 0 other;
     caggagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctatgtag ggtccttctt cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgcggttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg       300
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc       360
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       420
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       480
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccatgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac       720
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       840
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       900
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       960
     ggtcggggcg gggcggggct cgggggaccg ggctgacctc ggggtccggg ccaggttctc      1020
     acaccatcca gaggatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt      1080
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt      1140
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg      1200
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg      1260
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1320
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1380
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1440
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1500
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1560
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1620
     caatgtgtgt gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag      1680
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1740
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1800
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1860
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1920
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1980
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      2040
     ccaggcctgc aggggatgga accttccaga agtgggtggc tgtggtggtg ccttctggac      2100
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      2160
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      2220
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      2280
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2340
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2400
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2460
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2520
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2580
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2640
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2700
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2760
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2820
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2880
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2940
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      3000
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      3060
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      3120
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      3180
     acgaatttgt tcatgaatat ttttttctat agtgtgagac agctgccttg tgtgggactg      3240
     agaggcaaga gttgttcctg cccttccctt tgtgacttga agaaccctga ctttgtttct      3300
     gcaaaggcac ctgcatgtgt ctgtgttcgt gtaggcataa tgtgaggagg tggggagacc      3360
     accccacccc catgtccacc atgaccctct tcccacgctg acctgtgctc cctccccaat      3420
     catctttcct gttccagaga ggtggggctg aggtgtctcc atctctgtct caacttcatg      3480
     gtgcactgag ctgtaacttc ttccttccct attaaaa                               3517
//