Dbfetch

ID   AM234615; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM234615;
XX
DT   08-MAR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*3508 allele,
DE   exons 2-3
XX
KW   HLA-B gene; HLA-B*3508 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Vidan-Jeras B.;
RT   ;
RL   Submitted (06-MAR-2006) to the INSDC.
RL   Vidan-Jeras B., Tissue Typing Center, Blood Transfusion Center of Slovenia,
RL   Slajmerjeva 6, 1000 Ljubljana, SLOVENIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00790.x.
RX   PUBMED; 17389025.
RA   Vidan-Jeras B., Ambroz N., Fae I., Kemperle I., Fischer G.;
RT   "HLA-B*350802, a novel allele, which has arisen by silent mutation at codon
RT   67";
RL   Tissue Antigens 69(4):363-363(2007).
XX
DR   MD5; ab6328afcc5a4313df130d2cb9466c7d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /serotype="B35"
FT                   /mol_type="genomic DNA"
FT                   /country="Slovenia"
FT                   /sex="female"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="perypheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <74..>443
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3508"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*35:08:02"
FT                   /db_xref="UniProtKB/TrEMBL:Q2A0N9"
FT                   /protein_id="CAJ83997.1"
FT                   /translation="GLRGRHPVREVRQRRRESKDGAPGAMDRAGGAGVLGPEHTDLQDQ
FT                   HTDLPREPAEPARLLQPERGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLTSS
FT                   RGCMAATWGPTGASSAGMT"
FT   exon            <74..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3508"
FT                   /number=2
FT   variation       201
FT                   /replace="g"
FT   intron          271..370
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3508"
FT                   /number=2
FT   exon            371..>443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3508"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 174 C; 187 G; 72 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccaag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagcggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//