Dbfetch

ID   AM233567; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM233567;
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*2707 allele,
DE   exons 2-3, isolate 23444
XX
KW   HLA-B gene; HLA-B*2707 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Gervais T.G.;
RT   ;
RL   Submitted (02-MAR-2006) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Laboratories Tower,
RL   Molecular Biology, Level 0 N, Avenue Hippocrate, 10, Brussels, 1200,
RL   BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "Sequence for the HLA B*2707 gene obtained by sequence based typing";
RL   Unpublished.
XX
DR   MD5; abe4fea8475c291a47f5c2e9f80d8f74.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="23444"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<4..269,373..>646)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2707"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*27:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ELT3"
FT                   /protein_id="CAJ80804.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEASHTLQSMYGCDVGPD
FT                   GRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGECV
FT                   EWLRRYLENGKETLQRA"
FT   exon            4..269
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2707"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            373..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2707"
FT                   /number=3
XX
SQ   Sequence 646 BP; 107 A; 174 C; 195 G; 70 T; 100 other;
     ggctcccact ccatgaggta tttccacacc tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatca ccgtgggcta cgtggacgac acgctgttcg tgaggttcga cagcgacgcc       120
     gcgagtccga gagaggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       180
     gaccgggaga cacagatctg caaggccaag gcacagactg accgagagga cctgcggacc       240
     ctgctccgct actacaacca gagcgaggcc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gggtctcaca ccctccagag catgtacggc tgcgacgtgg ggccggacgg       420
     gcgcctcctc cgcgggcata accagtacgc ctacgacggc aaggattaca tcgccctgaa       480
     cgaggacctg cgctcctgga ccgccgcgga cacggcggct cagatcaccc agcgcaagtg       540
     ggaggcggcc cgtgtggcgg agcagctgag agcctacctg gagggcgagt gcgtggagtg       600
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcg                      646
//