Dbfetch

ID   AM233491; SV 1; linear; genomic DNA; STD; HUM; 1787 BP.
XX
AC   AM233491;
XX
DT   28-FEB-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*27new
DE   allele, exons 1-5
XX
KW   HLA-B gene; HLA-B*27new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1787
RA   Bengtsson M.;
RT   ;
RL   Submitted (28-FEB-2006) to the INSDC.
RL   Bengtsson M., Dep of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Egle Jansson I., Henrysson H., Bengtsson M.;
RT   "A new HLA B27 allele found in a Swedish family";
RL   Unpublished.
XX
DR   MD5; 353c17ac94720554db2ccf8ccd91ec33.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(65..137,267..536,781..1056,1250..1528,1622..>1738)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2A133"
FT                   /db_xref="IMGT/HLA:B*27:35"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2A133"
FT                   /protein_id="CAJ80695.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRAADPPKTHVTHHPISDH
FT                   EATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR
FT                   YTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            65..137
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=1
FT   intron          138..266
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=1
FT   exon            267..536
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=2
FT   intron          537..780
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=2
FT   exon            781..1056
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=3
FT   intron          1057..>1109
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=3
FT   gap             1110..1209
FT                   /estimated_length=unknown
FT   intron          <1210..1249
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=3
FT   exon            1250..1528
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=4
FT   intron          1529..1621
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=4
FT   exon            1622..1738
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=5
FT   intron          1739..>1787
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=5
XX
SQ   Sequence 1787 BP; 303 A; 524 C; 594 G; 266 T; 100 other;
     ccggggtccc agttctaaag tccccacgca cccacccgga ctcagaatct cctcagacgc        60
     cgagatgcgg gtcacggcgc cccgaaccct cctcctgctg ctctgggggg cagtggccct       120
     gaccgagacc tgggctggtg agtgcggggt cggcagggaa atggcctctg tggggaggag       180
     cgaggggacc gcaggcgggg gcgcaggacc cggggagccg cgccgggagg agggtcgggc       240
     gggtctcagc ccctcctcgc ccccaggctc ccactccatg aggtatttcc acacctccgt       300
     gtcccggccc ggccgcgggg agccccgctt catcaccgtg ggctacgtgg acgacacgct       360
     gttcgtgagg ttcgacagcg acgccgcgag tccgagagag gagccgcggg cgccgtggat       420
     agagcaggag gggccggagt attgggaccg ggagacacag atctgcaagg ccaaggcaca       480
     gactgaccga gaggacctgc ggaccctgct ccgctactac aaccagagcg aggccggtga       540
     gtgaccccgg cccggggcgc aggtcacgac tccccatccc ccacgtacgg cccgggtcgc       600
     cccgagtctc cgggtccgag atccgccccc gaggccgcgg gacccgccca gaccctcgac       660
     cggcgagagc cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc       720
     gggttggtcg gggcggggcg gggctcgggg ggacggggct gaccgcgggg gcggggccag       780
     ggtctcacac cctccagaat atgtatggct gcgacgtggg gccggacggg cgcctcctcc       840
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       900
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       960
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat      1020
     acctggagaa cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt      1080
     ccccatctcc tataggtcgc cggggatggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnt gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca      1260
     aagacacacg tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc      1320
     ctgggcttct accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact      1380
     caggacactg agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca      1440
     gctgtggtgg tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg      1500
     ctgccgaagc ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc      1560
     tcagggaaag caggagccct tcagcagggt cagggcccct catcttccct tcctttccca      1620
     gagccgtctt cccagtccac cgtccccatc gtgggcattg ttgctggcct ggctgtccta      1680
     gcagttgtgg tcatcggagc tgtggtcgct gctgtgatgt gtaggaggaa gagctcaggt      1740
     agggaagggg tgaggggtgg ggtctgggtt ttcttgtccc actgggg                    1787
//