spacer

EBI Dbfetch

ID   AM231297; SV 1; linear; genomic DNA; STD; HUM; 1910 BP.
XX
AC   AM231297;
XX
DT   21-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*0736 allele,
DE   exons 1-5
XX
KW   HLA-B gene; HLA-B*0736 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1910
RA   Bengtsson M.;
RT   ;
RL   Submitted (17-FEB-2006) to the INSDC.
RL   Bengtsson M., Dep of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M., Egle Jansson I.;
RT   "HLA B*0736, a HLA B7 with a Bw4 motif found in two Swedish families";
RL   Unpublished.
XX
DR   MD5; 2dc1d99cbc566bfa95c54c79eaf258d8.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1910
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(62..134,263..532,778..1053,1371..1644,1738..1854,
FT                   1738..>1854)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2HPN1"
FT                   /db_xref="IMGT/HLA:B*07:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HPN1"
FT                   /protein_id="CAJ77418.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRENLRI
FT                   ALRYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERAAPKTHVTHHPISDHEA
FT                   TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYT
FT                   CHVQHEGLPKPLTLRWGPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGPSS
FT                   QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSG"
FT   exon            62..134
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=1
FT   intron          135..262
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=1
FT   exon            263..532
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=2
FT   intron          533..777
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=2
FT   exon            778..1053
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=3
FT   intron          1054..>1167
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=3
FT   gap             1168..1267
FT                   /estimated_length=unknown
FT   intron          <1268..1370
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=3
FT   exon            1371..1644
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=4
FT   intron          1645..1737
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=4
FT   exon            1738..1854
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=5
FT   intron          1855..>1910
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0736"
FT                   /number=5
XX
SQ   Sequence 1910 BP; 333 A; 563 C; 619 G; 295 T; 100 other;
     cggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccga        60
     gatgctggtc atggcgcccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       120
     cgagacctgg gccggtgagt gcgggtcggg agggaaatgg cctctgccgg gaggagcgag       180
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       240
     ctcagcccct cctcaccccc aggctcccac tccatgaggt atttctacac ctccgtgtcc       300
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacccagttc       360
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       420
     caggaggggc cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact       480
     gaccgagaga acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       540
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       600
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       660
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       720
     gttggtcggg gcggggcggg gctcggggga ctgggctgac cgcggggccg gggccagggt       780
     ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       840
     ggcatgacca gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct       900
     cctggaccgc cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg       960
     aggcggagca gcggagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc      1020
     tggagaacgg gaaggacaag ctggagcgcg ctggtaccag gggcagtggg gagccttccc      1080
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1140
     gctagaatgt cgccctccgt tgaatggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnccc caggtgtcct gtccattctc aggctggtca catgggtggt cctagggtgt      1320
     cccatgaaag atgcaaagcg cctgaatttt ctgactcttc ccatcagacc ccccaaagac      1380
     acacgtgacc caccacccca tctctgacca tgaggccacc ctgaggtgct gggccctggg      1440
     tttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc aaactcagga      1500
     cactgagctt gtggagacca gaccagcagg agatagaacc ttccagaagt gggcagctgt      1560
     ggtggtgcct tctggagaag agcagagata cacatgccat gtacagcatg aggggctgcc      1620
     gaagcccctc accctgagat ggggtaagga gggggatgag gggtcatatc tcttctcagg      1680
     gaaagcagga gcccttcagc agggtcaggg cccctcatct tcccctcctt tcccagagcc      1740
     gtcttcccag tccaccgtcc ccatcgtggg cattgttgct ggcctggctg tcctagcagt      1800
     tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg aggaagagtt caggtaggga      1860
     aggggtgagg ggtggggtct gggttttctt gtcccactgg gggtttcaag                 1910
//


spacer
spacer