Dbfetch

ID   AM231063; SV 1; linear; genomic DNA; STD; HUM; 460 BP.
XX
AC   AM231063;
XX
DT   14-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*11new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-460
RA   Witter K.;
RT   ;
RL   Submitted (10-FEB-2006) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00720.x.
RX   PUBMED; 17176450.
RA   Witter K., Wittmann G., Lehmeier A.M., Albert T., Kauke T.;
RT   "A novel HLA-DRB1*11 allele, DRB1*1155, was found in a patient through
RT   routine DRB1 typing using sequence-specific primers (SSP) and confirmed by
RT   allele-specific sequence-based typing";
RL   Tissue Antigens 68(6):531-533(2006).
XX
DR   MD5; 94cce19c142c196ecd79d3df05e6b07b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..460
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   intron          <1..131
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /number=1
FT   CDS             <132..>401
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2HPT8"
FT                   /db_xref="IMGT/HLA:DRB1*11:55"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HPT8"
FT                   /protein_id="CAJ76979.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDERALVDTYCRHNYGVVESFTVQRR"
FT   exon            132..401
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /number=2
FT   intron          402..>460
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /number=2
XX
SQ   Sequence 460 BP; 79 A; 115 C; 175 G; 91 T; 0 other;
     gggcgttggg gcgggggccg gttaaggttc ccagtgcccg cacccggccc agggagcccc        60
     ggatggcggc gtcactgtca gtgtcttctc aggaggccgc ctgtgtgact ggatcgttcg       120
     tgtccccaca gcacgtttct tggagtactc tacgtctgag tgtcatttct tcaatgggac       180
     ggagcgggtg cggttcctgg acagatactt ctataaccaa gaggagtacg tgcgcttcga       240
     cagcgacgtg ggggagttcc gggcggtgac ggagctgggg cggcctgatg aggagtactg       300
     gaacagccag aaggacttcc tggaagacga gcgggccctg gtggacacct actgcagaca       360
     caactacggg gttgtggaga gcttcacagt gcagcggcga ggtgagcgcg gcgcggggcg       420
     gggcctgagt ccctgtgagc tgggaatctg agtgtgtgtg                             460
//