Dbfetch

ID   AM231062; SV 1; linear; genomic DNA; STD; HUM; 621 BP.
XX
AC   AM231062;
XX
DT   08-MAR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen,
DE   HLA-DQB1*0305GR allele, exon 2-3
XX
KW   HLA-DQB1 gene; HLA-DQB1*0305GR allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-621
RA   Hepkema B.;
RT   ;
RL   Submitted (08-FEB-2006) to the INSDC.
RL   Hepkema B., Transplantation Immunology, University Medical Center
RL   Groningen, PO box 30001, 9700RB Groningen, NETHERLANDS.
XX
RN   [2]
RA   Hepkema B., Visschedijk M.;
RT   "Characterization of a new HLA-DQB1 variant";
RL   Unpublished.
XX
DR   MD5; b42b8745eac074c123a0cf2beda74777.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..621
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <47..>317
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0305GR"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2A663"
FT                   /db_xref="IMGT/HLA:DQB1*03:05:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q2A663"
FT                   /protein_id="CAJ76977.1"
FT                   /translation="EDFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRA
FT                   VTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            47..317
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0305GR"
FT                   /number=2
FT   intron          318..>340
FT                   /gene="HLA-DQB1"
FT   gap             341..422
FT                   /estimated_length=82
FT   CDS             <423..>621
FT                   /codon_start=2
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0305GR"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q2A662"
FT                   /protein_id="CAJ76978.1"
FT                   /translation="NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWT
FT                   FQILVMLEMTPQRGDVYTCHV"
FT   exon            <423..>621
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0305GR"
FT                   /number=3
XX
SQ   Sequence 621 BP; 110 A; 154 C; 177 G; 98 T; 82 other;
     ctggggccgg gccggggcct gactgaccgg ccggtgattc cccgcagagg atttcgtgta        60
     ccagtttaag ggcatgtgct acttcaccaa cgggacggag cgcgtgcggg gtgtgaccag       120
     atacatctat aaccgagagg agtacgcacg cttcgacagc gacgtggggg tgtatcgggc       180
     ggtgacgccg ctggggccgc ctgccgccga gtactggaac agccagaagg aagtcctgga       240
     gaggacccgg gcggagttgg acacggtgtg cagacacaac taccagttgg agctccgcac       300
     gaccttgcag cggcgaggtg agcgtcgtcg cccgtctgcg nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nncaaccacc acaacctgct ggtctgctca gtgacagatt tctatccagc ccagatcaaa       480
     gtccggtggt ttcggaatga ccaggaggag acaactggcg ttgtgtccac cccccttatt       540
     aggaacggtg actggacctt ccagatcctg gtgatgctgg aaatgactcc ccagcgtgga       600
     gacgtctaca cctgccacgt g                                                 621
//