spacer

EBI Dbfetch

ID   AM230596; SV 1; linear; genomic DNA; STD; HUM; 811 BP.
XX
AC   AM230596;
XX
DT   09-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*27xx allele,
DE   exons 2-3
XX
KW   HLA-B gene; HLA-B*27xx allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-811
RA   Witter K.;
RT   ;
RL   Submitted (08-FEB-2006) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00705.x.
RX   PUBMED; 17176447.
RA   Witter K., Albert T., Volgger A., Zahn R., Scholz S.;
RT   "Routine HLA sequence-specific-oligonucleotide typing and confirming
RT   sequence-based typing of a prospective bone marrow donor identified a novel
RT   B*27 allele, HLA-B*2734";
RL   Tissue Antigens 68(6):527-528(2006).
XX
DR   MD5; c6162e2291c1af48e58a5e0761bc459a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B*27"
FT                   /allele="HLA-B*27xx"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2KT94"
FT                   /db_xref="IMGT/HLA:B*27:34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KT94"
FT                   /protein_id="CAJ76314.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27xx"
FT                   /number=2
FT   intron          271..513
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27xx"
FT                   /number=2
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27xx"
FT                   /number=3
FT   variation       657
FT                   /replace="a"
FT                   /compare=M62852.1
FT   variation       731
FT                   /replace="g"
FT                   /compare=M62852.1
XX
SQ   Sequence 811 BP; 141 A; 270 C; 297 G; 103 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     gggggactgg gctgaccgcg gggccggggc cagggtctca caccctccag agcatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg gacacagcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcggg taccaggggc agtggggagc c                                      811
//


spacer
spacer