spacer

EBI Dbfetch

ID   AM229666; SV 1; linear; genomic DNA; STD; HUM; 1004 BP.
XX
AC   AM229666;
XX
DT   21-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*15new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1004
RA   Altermann W.W.;
RT   ;
RL   Submitted (31-JAN-2006) to the INSDC.
RL   Altermann W.W., Interbranch HLA-Lab, Martin-Luther-University, Medical
RL   School, Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2006.00632.x.
RX   PUBMED; 16866898.
RA   Altermann W.W., Wahle A., Seliger B., Schlaf G.;
RT   "A novel HLA-B70 (B*9514) allele with an amino acid substitution (alanine
RT   to glycine at protein position 139) in a Caucasian heart allograft
RT   recipient";
RL   Tissue Antigens 68(2):185-187(2006).
XX
DR   MD5; a326e99adc54beef1c83e5d22806a37c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1004
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="PBL"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<3..271,517..>791)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2HPY1"
FT                   /db_xref="IMGT/HLA:B*15:114"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HPY1"
FT                   /protein_id="CAJ76277.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTGAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <3..271
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /number=2
FT   intron          272..516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /number=2
FT   exon            517..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /number=3
XX
SQ   Sequence 1004 BP; 192 A; 311 C; 352 G; 149 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggcctgg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacacggg       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca tctcctatag gtcgccgggg       840
     atggcctccc acgagaagag gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg       900
     aatggagaat ggcatgagtt ttcctgagtt tcctctgagg gccccctctt ctctctagga       960
     caattaaggg atgacgtctc tgaggaaatg gaggggaaga cagt                       1004
//


spacer
spacer