Dbfetch

ID   AM229665; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   AM229665;
XX
DT   21-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15new allele
XX
KW   HLA-B gene; HLA-B*15new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Altermann W.W.;
RT   ;
RL   Submitted (31-JAN-2006) to the INSDC.
RL   Altermann W.W., Interbranch HLA-Lab, Martin-Luther-University, Medical
RL   School, Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00632.x.
RX   PUBMED; 16866898.
RA   Altermann W.W., Wahle A., Seliger B., Schlaf G.;
RT   "A novel HLA-B70 (B*9514) allele with an amino acid substitution (alanine
RT   to glycine at protein position 139) in a Caucasian heart allograft
RT   recipient";
RL   Tissue Antigens 68(2):185-187(2006).
XX
DR   MD5; 14f806be5b49ba9dd5803ffff964b253.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="PBL"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <3..>822
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*15:114"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HPY2"
FT                   /protein_id="CAJ76276.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTGAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 822 BP; 180 A; 253 C; 277 G; 112 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acgggggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcggaccc cccaaagaca catgtgaccc accaccccat ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gcgaggacca aactcaggac accgagcttg tggagaccag accagcagga gatagaacct       720
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg       780
     tacagcatga ggggctgccg aagcccctca ccctgagatg gg                          822
//