spacer

EBI Dbfetch

ID   AM183783; SV 1; linear; genomic DNA; STD; HUM; 726 BP.
XX
AC   AM183783;
XX
DT   28-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen. HLA-A*2629 allele,
DE   exons 2-3
XX
KW   HLA-A gene; HLA-A*2629 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-726
RA   Binder T.M.C.;
RT   ;
RL   Submitted (28-JAN-2006) to the INSDC.
RL   Binder T.M.C., University Hospital Hamburg-Eppendorf, HLA Laboratory,
RL   Transfusion Medicine, Martinistrasse 52, D-20246 Hamburg, GERMANY.
XX
RN   [2]
RA   Binder T.M.C., Kuehnl P., Eiermann T.H.;
RT   "A new HLA-A*2601-like HLA-A*26 molecule.";
RL   Unpublished.
XX
DR   MD5; 6ae2ad1452f97c59d7bcd10215f86da3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..726
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..20
FT                   /gene="HLA-A"
FT                   /allele="A*2629"
FT                   /number=1
FT   CDS             join(<21..290,431..>706)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="A*2629"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q0VZ44"
FT                   /db_xref="IMGT/HLA:A*26:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VZ44"
FT                   /protein_id="CAJ70701.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRLDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            21..290
FT                   /gene="HLA-A"
FT                   /allele="A*2629"
FT                   /number=2
FT   intron          291..430
FT                   /gene="HLA-A"
FT                   /allele="A*2629"
FT                   /number=2
FT   gap             311..410
FT                   /estimated_length=unknown
FT   exon            431..706
FT                   /gene="HLA-A"
FT                   /allele="A*2629"
FT                   /number=3
FT   intron          707..>726
FT                   /gene="HLA-A"
FT                   /allele="A*2629"
FT                   /number=3
XX
SQ   Sequence 726 BP; 120 A; 197 C; 229 G; 80 T; 100 other;
     cagccactcc tcgcccccag gctcccactc catgaggtat ttctacacct ccgtgtcccg        60
     gcccggccgc ggggagcccc gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt       120
     gcggttggac agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca       180
     ggaggggccg gagtattggg accggaacac acggaatgtg aaggcccact cacagactga       240
     ccgagcgaac ctggggaccc tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc       300
     ccggcccggg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gacctcgggg       420
     tccgggccag gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       480
     cgcttcctcc gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac       540
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       600
     gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggacggg       660
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgggtac caggggccac       720
     ggggcg                                                                  726
//


spacer
spacer