Dbfetch

ID   AM183219; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM183219;
XX
DT   26-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*01 allele,
DE   exon 2
XX
KW   HLA-A gene; HLA-A*01 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Altermann W.W.;
RT   ;
RL   Submitted (25-JAN-2006) to the INSDC.
RL   Altermann W.W., Interbranch HLA-Lab, Martin-Luther-University, Medical
RL   School, Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1744-313X.2006.00606.x.
RX   PUBMED; 16893386.
RA   Schlaf G., Wahle A., Seliger B., Altermann W.W.;
RT   "A novel HLA-A*01 allele with a mutation in a highly conserved region in a
RT   Caucasian family";
RL   Int. J. Immunogenet. 33(4):247-248(2006).
XX
DR   MD5; f29e95d5436d71858d2e8b51e1bec855.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /cell_type="PBL"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentating molecule"
FT                   /db_xref="IMGT/HLA:A*01:19"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q2MCK0"
FT                   /protein_id="CAJ66086.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSED"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 84 C; 93 G; 37 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//