spacer

EBI Dbfetch

ID   AM182459; SV 1; linear; genomic DNA; STD; HUM; 1956 BP.
XX
AC   AM182459;
XX
DT   19-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*07 allele,
DE   exons 1-5
XX
KW   HLA-B gene; HLA-B*07 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1956
RA   Bengtsson M.;
RT   ;
RL   Submitted (19-JAN-2006) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,,
RL   SWEDEN.
XX
RN   [2]
RA   Egle Jansson I., Bengtsson M.;
RT   "A new HLA B*07 variant";
RL   Unpublished.
XX
DR   MD5; 987bbfe027a233b73ac1b6642348c384.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1956
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(81..153,282..551,797..1072,1430..1705,1799..>1915)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2MCN7"
FT                   /db_xref="IMGT/HLA:B*07:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2MCN7"
FT                   /protein_id="CAJ58442.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRVPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            81..153
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=1
FT   intron          154..281
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=1
FT   exon            282..551
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=2
FT   intron          552..796
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=2
FT   exon            797..1072
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=3
FT   intron          1073..1429
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=3
FT   gap             1211..1310
FT                   /estimated_length=unknown
FT   exon            1430..1705
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=4
FT   intron          1706..1798
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=4
FT   exon            1799..1915
FT                   /gene="HLA B"
FT                   /allele="B*07"
FT                   /number=5
XX
SQ   Sequence 1956 BP; 342 A; 577 C; 630 G; 307 T; 100 other;
     aagccaatca gcgtcgccgc ggtcccagtt ctaaagtccc cacgcaccca cccggactca        60
     gagtctcctc agacgccgag atgctggtca tggcgccccg aaccgtcctc ctgctgctct       120
     cggcggccct ggccctgacc gagacctggg ccggtgagtg cgggtcggga gggaaatggc       180
     ctctgccggg aggagcgagg ggaccgcagg cgggggcgca ggacctgagg agccgcgccg       240
     ggaggagggt cgggcgggtc tcagcccctc ctcaccccca ggctcccact ccatgaggta       300
     tttctacacc tccgtgtccc ggcccggccg cggggagccc cgcttcatct cagtgggcta       360
     cgtggacgac acccagttcg tgaggttcga cagcgacgcc gcgagtccga gagaggagcc       420
     gcgggtgccg tggatagagc aggaggggcc ggagtattgg gaccggaaca cacagatcta       480
     caaggcccag gcacagactg accgagagag cctgcggaac ctgcgcggct actacaacca       540
     gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg       600
     tacggcccgg gtcgccccga gtctccgggt ccgagatccg cctccctgag gccgcgggac       660
     ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt       720
     gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac tgggctgacc       780
     gcggggccgg ggccagggtc tcacaccctc cagagcatgt acggctgcga cgtggggccg       840
     gacgggcgcc tcctccgcgg gcatgaccag tacgcctacg acggcaagga ttacatcgcc       900
     ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg cggctcagat cacccagcgc       960
     aagtgggagg cggcccgtga ggcggagcag cggagagcct acctggaggg cgagtgcgtg      1020
     gagtggctcc gcagatacct ggagaacggg aaggacaagc tggagcgcgc tggtaccagg      1080
     ggcagtgggg agccttcccc atctcctata ggtcgccggg gatggcctcc cacgagaaga      1140
     ggaggaaaat gggatcagcg ctagaatgtc gccctccgtt gaatggagaa tggcatgagt      1200
     tttcctgagt nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gttctgtgcc      1320
     ccttccccac cccaggtgtc ctgtccattc tcaggctggt cacatgggtg gtcctagggt      1380
     gtcccatgaa agatgcaaag cgcctgaatt ttctgactct tcccatcaga ccccccaaag      1440
     acacacgtga cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg      1500
     ggtttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag      1560
     gacactgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa gtgggcagct      1620
     gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg      1680
     ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata tctcttctca      1740
     gggaaagcag gagcccttca gcagggtcag ggcccctcat cttcccctcc tttcccagag      1800
     ccgtcttccc agtccaccgt ccccatcgtg ggcattgttg ctggcctggc tgtcctagca      1860
     gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta ggaggaagag ttcaggtagg      1920
     gaaggggtga ggggtggggt ctgggttttc ttgtcc                                1956
//


spacer
spacer