spacer

EBI Dbfetch

ID   AM181591; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AM181591;
XX
DT   13-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*52new
DE   allele, exons 1-2
XX
KW   HLA-B gene; HLA-B*52new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Witter K.;
RT   ;
RL   Submitted (12-JAN-2006) to the INSDC.
RL   Witter K., Labor of Immunogenetics, University Munich, Paul-Heyse Strasse
RL   33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Keller E., Albert T.;
RT   "Spontanious mutation in the HLA-B locus leads to a novel HLA-B allele,
RT   HLA-B*52xx, confirmed by SBT in a patient suffering from AGS.";
RL   Unpublished.
XX
DR   MD5; d302e8e6b8990d500a3ba750b662839a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,516..>731)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2P9M2"
FT                   /db_xref="IMGT/HLA:B*52:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2P9M2"
FT                   /protein_id="CAJ57480.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEG"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new"
FT                   /number=1
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new"
FT                   /number=1
FT   variation       302
FT                   /allele="HLA-B*520102"
FT                   /replace="a"
FT   exon            516..731
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new"
FT                   /number=2
FT   intron          732..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new"
FT                   /number=2
XX
SQ   Sequence 791 BP; 143 A; 263 C; 280 G; 105 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gtgctgaccg cggggccggg gccagggtct cacacttggc agacgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaagat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer