spacer

EBI Dbfetch

ID   AM181332; SV 1; linear; genomic DNA; STD; HUM; 385 BP.
XX
AC   AM181332;
XX
DT   11-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-D gene for MHC class II antigen, HLA-DQB1*06new
DE   allele, exon 2
XX
KW   HLA-D gene; HLA-DQB1*06new allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-385
RA   Witter K.;
RT   ;
RL   Submitted (10-JAN-2006) to the INSDC.
RL   Witter K., Labor of Immunogenetics, University Munich, Paul-Heyse Strasse
RL   33, 80336 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00733.x.
RX   PUBMED; 17212715.
RA   Witter K., Albert T., Zahn R., Kauke T.;
RT   "A novel HLA-DQB1*06 allele, DQB1*0628, found through routine
RT   sequence-based HLA typing and confirmation of DQB1*060302";
RL   Tissue Antigens 69(1):102-103(2007).
XX
DR   MD5; 74f198754d2e1cf483b6459b6cf77032.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..385
FT                   /organism="Homo sapiens"
FT                   /isolate="158308"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>283
FT                   /gene="HLA-D"
FT                   /allele="HLA-DQB1*06new"
FT   CDS             <1..>283
FT                   /codon_start=3
FT                   /gene="HLA-D"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:28"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAJ57391.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRGERRR"
FT   exon            1..283
FT                   /gene="HLA-D"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=2
XX
SQ   Sequence 385 BP; 76 A; 104 C; 137 G; 68 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag gtgagcgtcg tcgcccctcc gtgaggccca       300
     cccttggccg agaccccgag tttctgtgcc gggaggggcg atgggggcga ggtctctgaa       360
     atctgagccc agttcattcc acccc                                             385
//


spacer
spacer