Dbfetch

ID   AM180651; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM180651;
XX
DT   30-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*02 variant
DE   allele NEE1205, exons 2-3
XX
KW   HLA-C gene; HLA-Cw*02 variant allele NEE1205; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Blasczyk R.;
RT   ;
RL   Submitted (23-DEC-2005) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Elamin N.E., Horn P.A., Elbashir M.I., Elkhidir I.M., Elghazali G.E.,
RA   Blasczyk R.;
RT   "A novel HLA-C*02 variation.";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2006.00789.x.
RX   PUBMED; 17493153.
RA   Elamin N.E., Elbashir M.I., Elkhiedir I.M., Elgazali G., Blasczyk R.,
RA   Horn P.A.;
RT   "Identification of four new HLA-Cw alleles in the Sudanese population";
RL   Tissue Antigens 69(3):270-272(2007).
XX
DR   MD5; 8c58dc6a4cd2ff4d8b3cb4c4f348b7c4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MHHNEE144"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,371..646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02 variant NEE1205"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02 variant NEE1205"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*02:14:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q2UV89"
FT                   /protein_id="CAJ55690.1"
FT                   /translation="SHSMRYFDTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02 variant NEE1205"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*02 variant NEE1205"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 169 C; 199 G; 68 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//