Dbfetch

ID   AM158320; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AM158320;
XX
DT   16-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*1502
DE   allele, exon 2
XX
KW   HLA-DPB1 gene; HLA-DPB1*1502 allele; human leucocyte antigen DPB1;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Cox S.;
RT   ;
RL   Submitted (16-NOV-2005) to the INSDC.
RL   Cox S., HLA Group, Anthony Nolan Research Institute, The Royal Free
RL   Hospital, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.;
RT   "A new DPB1 sequence";
RL   Unpublished.
XX
DR   MD5; 36539be1aabd18d79af0b51faacf1a75.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>267
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1502"
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1502"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation molecule"
FT                   /db_xref="GOA:Q2UVJ2"
FT                   /db_xref="IMGT/HLA:DPB1*112:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q2UVJ2"
FT                   /protein_id="CAJ43602.1"
FT                   /translation="ENYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVT
FT                   ELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..267
FT                   /gene="DPB1"
FT                   /allele="HLA-DPB1*1502"
FT                   /number=2
FT   variation       93..93
FT                   /gene="DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /replace="t"
FT                   /compare=AL645931.7
XX
SQ   Sequence 267 BP; 61 A; 68 C; 98 G; 40 T; 0 other;
     cagagaatta ccttttccag ggacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aaccgggagg agctcgtgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgctgcgga gtactggaac agccagaagg       180
     acatcctgga ggagaagcgg gcagtgccgg acaggatgtg cagacacaac tacgagctgg       240
     gcgggcccat gaccctgcag cgccgag                                           267
//