spacer

EBI Dbfetch

ID   AM158319; SV 1; linear; genomic DNA; STD; HUM; 3097 BP.
XX
AC   AM158319;
XX
DT   16-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-Cw gene for MHC class I antigen, HLA-Cw*1516 allele, exons
DE   1-8
XX
KW   HLA-Cw gene; HLA-Cw*1516 allele; human leucocyte antigen Cw;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3097
RA   Cox S.;
RT   ;
RL   Submitted (16-NOV-2005) to the INSDC.
RL   Cox S., HLA Group, Anthony Nolan Research Institute, The Royal Free
RL   Hospital, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.;
RT   "New HLA-Cw allele, Cw*1516";
RL   Unpublished.
XX
DR   MD5; 5deaec8b2872df254cf4ae1620af0d72.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3097
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,204..473,720..995,1583..1858,1890..2099,
FT                   2539..2571,2679..2726,2891..>2895)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT   CDS             join(1..73,204..473,720..995,1583..1858,1890..2099,
FT                   2539..2571,2679..2726,2891..2895)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation molecule"
FT                   /db_xref="GOA:Q2UVJ3"
FT                   /db_xref="IMGT/HLA:C*15:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2UVJ3"
FT                   /protein_id="CAJ43601.1"
FT                   /translation="MRVMAPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWAQGKQKSWSPSAGSGLRLGGQGPSPSPPFPEPSSQPTIPIVG
FT                   IVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=2
FT   variation       400..400
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1503"
FT                   /replace="c"
FT                   /compare=M99388.1
FT   intron          474..719
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=2
FT   exon            720..995
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=3
FT   intron          996..1582
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=3
FT   exon            1583..1858
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=4
FT   intron          1859..1889
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=4
FT   exon            1890..2099
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=5
FT   intron          2100..2538
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=5
FT   exon            2539..2571
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=6
FT   intron          2572..2678
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=6
FT   exon            2679..2726
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=7
FT   intron          2727..2890
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=7
FT   exon            2891..>2895
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1516"
FT                   /number=8
XX
SQ   Sequence 3097 BP; 581 A; 894 C; 976 G; 646 T; 0 other;
     atgcgggtca tggcgccccg aaccctcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgtgagtg cggggttggg agggaaacgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggagagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccgagtg aacctgcgga aactgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     cccgagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggctggggcg gggctcgggg gacggggctg accacggggg cggggccagg       720
     gtctcacatc atccagagga tgtatggctg cgacctgggg cccgacgggc gcctcctccg       780
     cgggcatgac cagttagcct acgacggcaa ggattacatc gccctgaacg aggacctgcg       840
     ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgaggcggag cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1020
     cctatctcct gtagatctcc cgggatggcc ttccacgagg aggggaggaa aatgggatca      1080
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1140
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1200
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1260
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcacg ctcaatgtgt      1320
     ttgaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      1380
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      1440
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtcca      1500
     ttctcaggat ggtcacatgg gcgctgttgg agtgtcgcaa gagagataca aagtgtctga      1560
     attttctgac tcttcccgtc agaacaccca aagacacacg tgacccacca tcccgtctct      1620
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1680
     acctggcagc gggatggcga ggaccaaact caggacaccg agcttgtgga gaccaggcca      1740
     gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      1800
     agatacacgt gccatgtgca gcacgagggg ctgccggagc ccctcaccct gagatggggt      1860
     aaggaggggg atgaggggtc atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      1920
     agctgggtca gggctgaggc ttgggggtca gggcccctca ccttcccctc ctttcccaga      1980
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      2040
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      2100
     tagggaaggg gtgaggagtg gggtctgggt tttcttgtcc cactgggagt ttcaagcccc      2160
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      2220
     ctgggaccct gtgtgccagc acttactctg ttgtgaagca catgacaatg aaggacagat      2280
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      2340
     aggtccctgc taaggacaga ccttaggagg gcagttgctc cagaacccac agctgctttc      2400
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      2460
     ccaagactag gaggttcccc taagatcgca tggccctgcc tcctccctgt cccctcacag      2520
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      2580
     ggcggtgggc gtgtggagga gcttacccac cccataattc ctcttgtccc acatctcctg      2640
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      2700
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtcgggggtg      2760
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      2820
     gtgagctgtt cagagtgtca tcacttacca tgactgacct gaatttgttc atgactattg      2880
     tgttctgtag cctgagacag ctgcctgtgt gggactgaga tgcaggattt cttcacacct      2940
     ctcctttgtg acttcaagag cctctggcat ctctttctgc aaaggcatct gaatgtgtct      3000
     gcgttcctgt tagcataatg tgaggaggtg gagagacagc ccacccccgt gtccaccgtg      3060
     acccctgtcc ccacactgac ctgtgttccc tccccga                               3097
//


spacer
spacer