Dbfetch

ID   AM158301; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM158301;
XX
DT   17-NOV-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*08new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*08new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Goodman R.S.;
RT   ;
RL   Submitted (02-NOV-2005) to the INSDC.
RL   Goodman R.S., Tissue Typing, Addenbrooke's NHS Trust, Hills Road,
RL   Cambridge, CB2 2QQ, UNITED KINGDOM.
XX
RN   [2]
RA   Goodman R.S., O'Rourke C.M., Key T., Taylor C.J.;
RT   "A new HLA-B8 allele";
RL   Unpublished.
XX
DR   MD5; fc7c2136084f244e5a32187c0c4f938c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..>546)
FT                   /gene="HLA-B"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   CDS             join(<1..270,371..>546)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*08:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YHP4"
FT                   /protein_id="CAJ43599.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEA"
FT   gap             271..370
FT                   /estimated_length=unknown
FT                   /note="intron 2"
FT   exon            371..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=3
FT   intron          547..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 172 C; 191 G; 69 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgat agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//