Dbfetch

ID   AM157129; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AM157129;
XX
DT   04-NOV-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, exons 2-3, allele
DE   HLA-Cw*03
XX
KW   HLA-Cw gene; HLA-Cw*03 allele; human leucocyte antigen Cw;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Meenagh A.V.;
RT   ;
RL   Submitted (03-NOV-2005) to the INSDC.
RL   Meenagh A.V., Histocompatability and Immunogenetics, Belfast City Hospital,
RL   Lisburn Road, Belfast, N.Ireland, BT9 7TS, UNITED KINGDOM.
XX
RN   [2]
RA   Meenagh A.V., Middleton D.;
RT   "Novel Cw*03 allele not detectable by common serological methods";
RL   Unpublished.
XX
DR   MD5; 406b42a8dc80c76fe012557ab16988ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-Cw"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*03:22Q"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q333A7"
FT                   /protein_id="CAJ42902.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGYDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT                   /number=3
XX
SQ   Sequence 791 BP; 144 A; 255 C; 284 G; 108 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggcca gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc tcatccccca cggacggccc gggtcgcccc aagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cgggggcggg gccagggtct cacatcatcc agaggatgta       540
     tggctacgac gtggggcccg acgggcgcct cctccgcggg tatgaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga tctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg aagaatggga aggagacgct       780
     gcagcgcgcg g                                                            791
//