spacer

EBI Dbfetch

ID   AM114422; SV 1; linear; genomic DNA; STD; HUM; 878 BP.
XX
AC   AM114422;
XX
DT   19-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*401403
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*401403 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-878
RA   Hammond L.;
RT   ;
RL   Submitted (17-OCT-2005) to the INSDC.
RL   Hammond L., Molecular Genetics, Welsh Transplant & Immunogentics Lab, Welsh
RL   Blood Service, Ely Valley Road, Talbot Green, Pontyclun, CF72 9WB, UNITED
RL   KINGDOM.
XX
RN   [2]
RA   Street J., Hammond L., Darke C.;
RT   "Confirmatory sequence, serology and genetics of HLA-B*401403";
RL   Unpublished.
XX
DR   MD5; fc9c8a418ce7f2a36bf58bb4bc38b3ae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..878
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="11169540"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..24
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*401403"
FT                   /number=1
FT   CDS             join(<25..294,540..>815)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*401403"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3BJY4"
FT                   /db_xref="IMGT/HLA:B*40:14:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BJY4"
FT                   /protein_id="CAJ38415.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            25..294
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*401403"
FT                   /number=2
FT   intron          295..539
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*401403"
FT                   /number=2
FT   exon            540..815
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*401403"
FT                   /number=3
FT   intron          816..>878
FT                   /gene="HLA-B"
FT                   /allele="B*401403"
FT                   /number=3
XX
SQ   Sequence 878 BP; 157 A; 297 C; 306 G; 118 T; 0 other;
     gtctcagctc ctcctcgccc ccaggctccc actccatgag gtatttccac accgccatgt        60
     cccggcccgg ccgcggggag ccccgcttca tcaccgtggg ctacgtggac gacacgctgt       120
     tcgtgaggtt cgacagcgac gccacgagtc cgaggaagga gccgcgggcg ccatggatag       180
     agcaggaggg gccggagtat tgggaccggg agacacagat ctccaagacc aacacacaga       240
     cttaccgaga gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt       300
     gaccccggcc cggggcgcag gtcacgactc cccatccccc acgtacggcc cgggtcgccc       360
     cgagtctccg ggtccgagat ccgaccccct gaggccgcgg gacccgccca gaccctcgac       420
     cggcgagagc cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc       480
     gggttggtcg gggcggggcg gggctcgggg gactgggctg accgcggggc cggggccagg       540
     gtctcacacc ctccagagga tgtacggctg cgacgtgggg ccggacgggc gcctcctccg       600
     cgggcataac cagtacgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg       660
     ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg       720
     tgtggcggag cagctgagag cctacctgga gggcgagtgc gtggagtggc tccgcagata       780
     cctggagaac gggaaggaca agctggagcg cgctggtacc aggggcagtg gggagccttc       840
     cccatctcct ataggtcgcc ggggatggcc tcccacga                               878
//


spacer
spacer