spacer

EBI Dbfetch

ID   AM109974; SV 1; linear; genomic DNA; STD; HUM; 638 BP.
XX
AC   AM109974;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*0704,
DE   exons 2-3
XX
KW   HLA-DRB1 gene; HLA-DRB1*0704 allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-638
RA   Blasczyk R.;
RT   ;
RL   Submitted (26-SEP-2005) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Albis-Camps M., Bunce M., Yousaf K., Williams S., Blasczyk R.;
RT   "The nature of diversity of HLA-DRB1 exon 3.";
RL   Unpublished.
XX
DR   MD5; 09a37157bd54d465327c483ec94c2a4b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..638
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>638)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0704"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3LAB6"
FT                   /db_xref="IMGT/HLA:DRB1*07:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LAB6"
FT                   /protein_id="CAJ33581.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRGQVDNYCRHNYGVGESFTVQRRVHPEVTVYPAKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVMSPL"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0704"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>638
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0704"
FT                   /number=3
XX
SQ   Sequence 638 BP; 119 A; 134 C; 177 G; 108 T; 100 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctga ggtgactgtg tatcctgcca agactcagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaagtttac       600
     acctgccaag tggagcaccc aagtgtgatg agccctct                               638
//


spacer
spacer