spacer

EBI Dbfetch

ID   AM109973; SV 1; linear; genomic DNA; STD; HUM; 644 BP.
XX
AC   AM109973;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*0434,
DE   exons 2-3
XX
KW   HLA-DRB1 gene; HLA-DRB1*0434 allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-644
RA   Blasczyk R.;
RT   ;
RL   Submitted (26-SEP-2005) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Albis-Camps M., Bunce M., Yousaf K., Williams S., Blasczyk R.;
RT   "The nature of diversity of HLA-DRB1 exon 3.";
RL   Unpublished.
XX
DR   MD5; 3dca5c9090085bd278b9e76d9684d64b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..644
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>644)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0434"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3LAB7"
FT                   /db_xref="IMGT/HLA:DRB1*04:34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LAB7"
FT                   /protein_id="CAJ33580.1"
FT                   /translation="RFLEQVKPECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPL
FT                   QHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSLTSPLTV"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0434"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>644
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0434"
FT                   /number=3
XX
SQ   Sequence 644 BP; 122 A; 142 C; 175 G; 105 T; 100 other;
     cacgtttctt ggagcaggtt aaacctgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tctatcctga ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcctgacg agccctctca cagt                        644
//


spacer
spacer