spacer

EBI Dbfetch

ID   AM087957; SV 1; linear; genomic DNA; STD; HUM; 937 BP.
XX
AC   AM087957;
XX
DT   03-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*03new,
DE   exons 2-3, isolate 11845457
XX
KW   HLA-C gene; HLA-Cw*03new allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-937
RA   Hammond L.;
RT   ;
RL   Submitted (30-SEP-2005) to the INSDC.
RL   Hammond L., Molecular Genetics, Welsh Transplant & Immunogenetics Lab,
RL   Welsh Blood Service, Ely Valley Road, Talbot Green, Pontyclun, CF72 9WB,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00691.x.
RX   PUBMED; 17092264.
RA   Hammond L., Street J., Johnson J., Pepperall J., Darke C.;
RT   "A new HLA-Cw*03 variant - Cw*031102";
RL   Tissue Antigens 68(5):455-456(2006).
XX
DR   MD5; 1ce9065156da736e29140de3d00a065e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..937
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="11845457"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="mixed leucocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..33
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=1
FT   mRNA            join(<34..303,549..>824)
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT   CDS             join(<34..303,549..>824)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3LAF7"
FT                   /db_xref="IMGT/HLA:C*03:11:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LAF7"
FT                   /protein_id="CAJ32664.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            34..303
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=2
FT   intron          304..548
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=2
FT   exon            549..824
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=3
FT   intron          825..>937
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=3
XX
SQ   Sequence 937 BP; 168 A; 303 C; 331 G; 135 T; 0 other;
     gtcgggcggg tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca        60
     ccgctgtgtc ccggcccggc cgcggggagc cccgcttcat ctcagtgggc tacgtggacg       120
     acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc       180
     cgtgggtgga gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc       240
     aggcacagac tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg       300
     ccagtgagtg accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg       360
     cccgggtcgc cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag       420
     accctcgacc ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa       480
     aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcgggggc       540
     ggggccaggg tctcacatca tccagaggat gtatggctgc gacgtggggc ccgacgggcg       600
     cctcctccgc gggtatgacc agtacgccta cgacggcaag gattacatcg ccctgaacga       660
     ggatctgcgc tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga       720
     ggcggcccgt gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct       780
     ccgcagatac ctgaagaatg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg       840
     ggagccttcc ccatctcctg tagatctccc gggatggcct cccacgagga ggggaggaaa       900
     atgggatcag cgctagaata tcgccctccc ttgaatg                                937
//


spacer
spacer