spacer

EBI Dbfetch

ID   AM087553; SV 1; linear; genomic DNA; STD; HUM; 649 BP.
XX
AC   AM087553;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*14
DE   allele, MAC0905 variant, exons 2-3, isolate Dynal22
XX
KW   HLA-DRB1 gene; HLA-DRB1*14 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-649
RA   Blasczyk R.;
RT   ;
RL   Submitted (27-SEP-2005) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00918.x.
RX   PUBMED; 17767557.
RA   Horn P.A., Albis-Camps M., Verboom M., Bunce M., Yousaf K., Williams S.,
RA   Blasczyk R.;
RT   "The nature of diversity of HLA-DRB1 exon 3";
RL   Tissue Antigens 70(4):335-337(2007).
XX
DR   MD5; cd3bcfcedf7834e525ca658a36c08bed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Dynal22"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>649)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="MAC0905 variant"
FT                   /db_xref="GOA:Q3LAG4"
FT                   /db_xref="IMGT/HLA:DRB1*14:54:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LAG4"
FT                   /protein_id="CAJ32475.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVE"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..649
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /number=3
XX
SQ   Sequence 649 BP; 120 A; 139 C; 179 G; 111 T; 100 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctgc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaat                   649
//


spacer
spacer