Dbfetch

ID   AM087470; SV 1; linear; genomic DNA; STD; HUM; 3370 BP.
XX
AC   AM087470;
XX
DT   26-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*2732
XX
KW   HLA-B gene; HLA-B*2732 allele; human leucocyte antigen B;
KW   major histocompatibility complex, MHC class I allele.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3370
RA   Cox S.T.;
RT   ;
RL   Submitted (26-SEP-2005) to the INSDC.
RL   Cox S.T., HLA Research Group, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Novel B*27";
RL   Unpublished.
XX
DR   MD5; a8d30ac1373721318444f4c85712d0dc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3370
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(302..374,504..773,1018..1293,1869..2144,2238..2354,
FT                   2796..2828,2935..2978)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT   CDS             join(302..374,504..773,1018..1293,1869..2144,2238..2354,
FT                   2796..2828,2935..2978)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q3BK34"
FT                   /db_xref="IMGT/HLA:B*27:32"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BK34"
FT                   /protein_id="CAJ32465.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRT
FT                   LLRYYNQSEAGSHTLQSMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=1
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=2
FT   intron          774..1017
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=2
FT   exon            1018..1293
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=3
FT   intron          1294..1868
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=3
FT   exon            1869..2144
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=4
FT   intron          2145..2237
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=4
FT   exon            2238..2354
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=5
FT   intron          2355..2795
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=5
FT   exon            2796..2828
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=6
FT   intron          2829..2934
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=6
FT   exon            2935..2978
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2732"
FT                   /number=7
XX
SQ   Sequence 3370 BP; 614 A; 979 C; 1072 G; 705 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc attggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccctcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gctggtgagt gcggggtcgg cagggaaatg gcctctgtgg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttccaca cctccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt       600
     cgtgaggttc gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tgcaaggcca aggcacagac       720
     tgaccgagag gacctgcgga ccctgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcccccgag gccgcgggac ccgcccagac cctcgaccgg       900
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       960
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcgggggcg gggccagggt      1020
     ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg      1080
     ggtaccacca ggacgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct      1140
     cctggaccgc cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg      1200
     tggcggagca gctgagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc      1260
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1320
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1380
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1440
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1500
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1560
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1620
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1680
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1740
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1800
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1860
     cccatcagac cccccaaaga cacacgtgac ccaccacccc atctctgacc atgaggccac      1920
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1980
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      2040
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      2100
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      2160
     ggggtcatat ctcttctcag ggaaagcagg agcccttcag cagggtcagg gcccctcatc      2220
     ttcccttcct ttcccagagc cgtcttccca gtccaccgtc cccatcgtgg gcattgttgc      2280
     tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctgctg tgatgtgtag      2340
     gaggaagagc tcaggtaggg aaggggtgag gggtggggtc tgagttttct tgtcccactg      2400
     ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt actgggaagc agcatccaca      2460
     caggggctaa cgcagcctgg gaccctgtgt gccagcactt actcttttgt gcagcacatg      2520
     tgacaatgaa ggacggatgt atcaccttgg tggttgtggt gttggggtcc tgattccagc      2580
     attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca gttggtccag      2640
     gacccacact tgctttcctc gtgtttcctg atcctgcctt gggtctgtag tcatacttct      2700
     ggaaattcct tttgggtcca agacgaggag gttcctctaa gatctcatgg ccctgcttcc      2760
     tcccagtccc ctcacagggc attttcttcc cacaggtgga aaaggaggga gctactctca      2820
     ggctgcgtgt aagtgatggg ggtgggagtg tggaggagct cacccacccc ctaattcctc      2880
     ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt ttgttctact ccaggcagcg      2940
     acagtgccca gggctctgat gtgtctctca cagcttgaaa aggtgagatt cttggggtct      3000
     agagtgggtg gggtggcagg tctgggggtg ggtggggcag tggggaaagg cctgggtaat      3060
     ggagattctt tgattgggat gtttcgcgtg tgtggtgggc tgtttagact gtcatcactt      3120
     accatgacta accagaattt gttcatgact gttgttttct gtagcctgag acagctgtct      3180
     tgtgagggac tgagatgcag gatttcttca cgcctcccct ttgtgacttc aagagcctct      3240
     ggcatctctt tctgcaaagg cacctgaatg tgtctgcgtc cctgttagca taatgtgagg      3300
     aggtggagag accagcccac ccccgtgtcc actgtgaccc ctgttcgcat gctgacctgt      3360
     gtttcctccc                                                             3370
//