spacer

EBI Dbfetch

ID   AM087018; SV 1; linear; genomic DNA; STD; HUM; 880 BP.
XX
AC   AM087018;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*15new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-880
RA   Hammond L.;
RT   ;
RL   Submitted (20-SEP-2005) to the INSDC.
RL   Hammond L., Molecular Genetics, Welsh Transplant & Immunogenetics Lab,
RL   Welsh Blood Service, Ely Valley Road, Talbot Green, Pontyclun, CF72 9WB,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00936.x.
RX   PUBMED; 17927687.
RA   Hammond L., Street J., Johnson J., Pepperall J., Darke C.;
RT   "A new HLA-B*15 variant - B*9507";
RL   Tissue Antigens 70(6):519-521(2007).
XX
DR   MD5; 9957d3bfe5e6aae4b3241b00e9a2a9eb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..880
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="13890190"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="mixed leucocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..27
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /number=1
FT   mRNA            join(<28..297,543..>818)
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT   CDS             join(<28..297,543..>818)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3MQ00"
FT                   /db_xref="IMGT/HLA:B*15:107"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3MQ00"
FT                   /protein_id="CAJ31317.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            28..297
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /number=2
FT   intron          298..542
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /number=2
FT   exon            543..818
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /number=3
FT   intron          819..>880
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /number=3
XX
SQ   Sequence 880 BP; 150 A; 303 C; 308 G; 119 T; 0 other;
     cgggtctcag cccctcctcg cccccaggct cccactccat gaggtatttc tacaccgcca        60
     tgtcccggcc cggccgcggg gagccccgct tcatcgcagt gggctacgtg gacgacaccc       120
     agttcgtgag gttcgacagc gacgccgcga gtccgaggat ggcgccccgg gcgccatgga       180
     tagagcagga ggggccggag tattgggacc gggagacaca gatctccaag accaacacac       240
     agacttaccg agagagcctg cggaacctgc gcggctacta caaccagagc gaggccggtg       300
     agtgaccccg gcctggggcg caggtcacga ctccccatcc cccacgtacg gcccgggtcg       360
     ccccgagtct ccgggtccga gatccgcccc cctgaggccg cgggacccgc ccaaaccctc       420
     gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg ccaaaatccc       480
     cgcgggttgg tcggggcggg gcggggctcg ggggacgggg ctgaccgcgg ggcctgggcc       540
     agggtctcac accctccaga ggatgtacgg ctgcgacgtg gggccggacg ggcgcctcct       600
     ccgcgggcat gaccagtccg cctacgacgg caaggattac atcgccctga acgaggacct       660
     gcgctcctgg accgccgcgg acacggcggc tcagatcacc cagcgcaagt gggaggcggc       720
     ccgtgtggcg gagcagctga gagcctacct ggagggcctg tgcgtggagt ggctccgcag       780
     atacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca gtggggagcc       840
     ttccccatct cctataggtc gccggggatg gcctcccacg                             880
//


spacer
spacer