Dbfetch

ID   AM086443; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AM086443;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*13new allele, exons
DE   2 and 3, isolate 118591,156688
XX
KW   HLA-B gene; HLA-B*13new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Witter K.;
RT   ;
RL   Submitted (16-SEP-2005) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00749.x.
RX   PUBMED; 17257325.
RA   Witter K., Zahn R., Lubke S., Albert T., Kauke T.;
RT   "A novel HLA-B*13 allele, B*1314, was found through routine HLA class I
RT   sequence-specific oligonucleotide typing and confirmed by sequence-based
RT   HLA typing";
RL   Tissue Antigens 69(2):201-202(2007).
XX
DR   MD5; 7205631030729bf44e0e5aa6954fada7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="118591,156688"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*13:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3MQ30"
FT                   /protein_id="CAJ31083.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /number=3
XX
SQ   Sequence 791 BP; 142 A; 265 C; 278 G; 106 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgg acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggccggg gccagggtct cacacttggc agacgatgta       540
     tggctgcgac ctggggccgg acgggcgcct cctccgcggg cataaccagt tagcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagctca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//