Dbfetch

ID   AM086025; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM086025;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*13MVE0805 allele, exon 2, isolate MHHZ-00014883
XX
KW   HLA-DRB1 gene; HLA-DRB1*13MVE0805 allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (14-SEP-2005) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00580.x.
RX   PUBMED; 16634878.
RA   Horn P.A., Zingsem J., Eckstein R., Blasczyk R.;
RT   "Novel HLA-DRB1*1370 allele identified in a cord blood donor and her
RT   mother";
RL   Tissue Antigens 67(4):345-347(2006).
XX
DR   MD5; 280b6a68971ed52e8665dca0e8a31567.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00014883"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13MVE0805"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:70"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAJ30431.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13MVE0805"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 64 C; 96 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//