spacer

EBI Dbfetch

ID   AM076769; SV 1; linear; genomic DNA; STD; HUM; 1142 BP.
XX
AC   AM076769;
XX
DT   23-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*02xxN, exons
DE   2-4
XX
KW   HLA-A gene; HLA-A*02xxN allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1142
RA   Binder T.M.C.;
RT   ;
RL   Submitted (23-AUG-2005) to the INSDC.
RL   Binder T.M.C., University Hospital Hamburg-Eppendorf, HLA Laboratory,
RL   Transfusion Medicine, Martinistrasse 52, D-20246 Hamburg, GERMANY.
XX
RN   [2]
RA   Binder T.M.C., Kuehnl P., Eiermann T.H.;
RT   "A new serologically undetectable HLA-A*02 variant (Null allele).";
RL   Unpublished.
XX
DR   MD5; a0595f63b0ee9d99c49f90acbc1e4908.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000413609; homo_sapiens.
DR   Ensembl-Tr; ENST00000438861; homo_sapiens.
DR   Ensembl-Tr; ENST00000453057; homo_sapiens.
DR   Ensembl-Tr; ENST00000453975; homo_sapiens.
DR   Ensembl-Tr; ENST00000455882; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1142
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..20
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=1
FT   mRNA            join(<21..290,431..706,847..>1122)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT   CDS             join(<21..290,431..507)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="truncated by stop codon"
FT                   /db_xref="GOA:Q2HQJ5"
FT                   /db_xref="IMGT/HLA:A*02:88N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HQJ5"
FT                   /protein_id="CAJ28360.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQ"
FT   exon            21..290
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=2
FT   intron          291..430
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=2
FT   gap             311..410
FT                   /estimated_length=unknown
FT   exon            431..706
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=3
FT   intron          707..846
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=3
FT   gap             727..826
FT                   /estimated_length=unknown
FT   exon            847..1122
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=4
FT   intron          1123..>1142
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02xxN"
FT                   /number=4
XX
SQ   Sequence 1142 BP; 192 A; 273 C; 339 G; 138 T; 200 other;
     ggtcgggagg gaaacggcag gctctcactc catgaggtat ttcttcacat ccgtgtcccg        60
     gcccggccgc ggggagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt       120
     gcggttcgac agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca       180
     ggagggtccg gagtattggg acggggagac acggaaagtg aaggcccact cacagactca       240
     ccgagtggac ctggggaccc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc       300
     ccggcccggg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gaccgcgggg       420
     tccgggccag gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg       480
     cgcttcctcc gcgggtacca ccagtaggcc tacgacggca aggattacat cgccctgaaa       540
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       600
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       660
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgggtac caggggccac       720
     ggggcgnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngatc tgactcttcc       840
     tgacagacgc ccccaaaacg catatgactc accacgctgt ctctgaccat gaagccaccc       900
     tgaggtgctg ggccctgagc ttctaccctg cggagatcac actgacctgg cagcgggatg       960
     gggaggacca gacccaggac acggagctcg tggagaccag gcctgcaggg gatggaacct      1020
     tccagaagtg ggcggctgtg gtggtgcctt ctggacagga gcagagatac acctgccatg      1080
     tgcagcatga gggtttgccc aagcccctca ccctgagatg gggtaaggag ggagacgggg      1140
     gt                                                                     1142
//


spacer
spacer