spacer

EBI Dbfetch

ID   AM075814; SV 1; linear; genomic DNA; STD; HUM; 866 BP.
XX
AC   AM075814;
XX
DT   29-AUG-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC Class I antigen, HLA-B*55new
DE   allele, exons 2 and 3
XX
KW   HLA-B gene; HLA-B*55new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-866
RA   Hammond L.;
RT   ;
RL   Submitted (16-AUG-2005) to the INSDC.
RL   Hammond L., Department of Molecular Genetics, Welsh Transplant &
RL   Immunogenetics Laboratory, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, CF72 9WB, Wales, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00633.x.
RX   PUBMED; 16866895.
RA   Hammond L., Street J., Downing J., Pepperall J., Darke C.;
RT   "A new HLA-B*5501 variant--B*550104";
RL   Tissue Antigens 68(2):182-183(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..866
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="33137"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="mixed leucocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..12
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=1
FT   CDS             join(<13..282,528..>803)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3ZUS9"
FT                   /db_xref="IMGT/HLA:B*55:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZUS9"
FT                   /protein_id="CAJ27509.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            13..282
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=2
FT   intron          283..527
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=2
FT   exon            528..803
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=3
FT   variation       619
FT                   /allele="HLA-B*550101"
FT                   /replace="g"
FT                   /compare=AJ310509
FT                   /note="silent base substitution A619G differentiates
FT                   HLA-B*55new from HLA-B*550101"
FT   intron          804..>866
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=3
XX
SQ   Sequence 866 BP; 155 A; 288 C; 309 G; 114 T; 0 other;
     cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc        60
     gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacgcagttc gtgaggttcg       120
     acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag caggaggggc       180
     cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact gaccgagaga       240
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       300
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       360
     tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg gcgagagccc       420
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg       480
     gcggggcggg gctcggggga cggggctgac cgcggggccg gggccagggt ctcacacttg       540
     gcagacgatg tatggctgcg acctggggcc ggacgggcgc ctcctccgcg ggcataacca       600
     gttagcctac gacggcaaag attacatcgc cctgaacgag gacctgagct cctggaccgc       660
     ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca       720
     gctgagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg       780
     gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcctat       840
     aggtcgccgg ggatggcctc ccacga                                            866
//


spacer
spacer