spacer

EBI Dbfetch

ID   AM055594; SV 1; linear; genomic DNA; STD; HUM; 3379 BP.
XX
AC   AM055594;
XX
DT   27-AUG-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*550103 allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*550103 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3379
RA   Cox S.T.;
RT   ;
RL   Submitted (27-JUL-2005) to the INSDC.
RL   Cox S.T., HLA Research Group, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "New HLA-B allele";
RL   Unpublished.
XX
DR   MD5; 0ba2525966dacf1f1e97f8c87bc071e0.
XX
CC   Related entry AJ310509
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3379
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,503..772,1018..1293,1869..2144,2249..2365,
FT                   2807..2839,2946..2989)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3ZV43"
FT                   /db_xref="IMGT/HLA:B*55:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZV43"
FT                   /protein_id="CAJ20016.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=1
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=1
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=2
FT   intron          773..1017
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=2
FT   exon            1018..1293
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=3
FT   intron          1294..1868
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=3
FT   exon            1869..2144
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=4
FT   variation       2026
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5501"
FT                   /replace="a"
FT                   /note="silent"
FT   intron          2145..2248
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=4
FT   exon            2249..2365
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=5
FT   intron          2366..2806
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=5
FT   exon            2807..2839
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=6
FT   intron          2840..2945
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=6
FT   exon            2946..>2989
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550103"
FT                   /number=7
XX
SQ   Sequence 3379 BP; 624 A; 975 C; 1070 G; 710 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccatgtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcattggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacaccga       300
     gatgcgggtc acggcacccc gaaccctcct cctgctgctc tggggggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggg agggaaatgg cctctgtggg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tctggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacgcagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       660
     caggaggggc cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact       720
     gaccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcggg gcggggcggg gctcggggga cggggctgac cgcggggccg gggccagggt      1020
     ctcacacttg gcagacgatg tatggctgcg acctggggcc ggacgggcgc ctcctccgcg      1080
     ggcataacca gttagcctac gacggcaagg attacatcgc cctgaacgag gacctgagct      1140
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg      1200
     aggcggagca gctgagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc      1260
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1320
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1380
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1440
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1500
     gacagtccct agaatactga tcaggggtcc tctttgaccc ctgcagcagc cttgggaacc      1560
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1620
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1680
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1740
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1800
     acatgggtgg tcctagggtg tcctatgaga gatgcaaagc gcctgaattt tctgactctt      1860
     cccatcagac cccccaaaga cacacgtgac ccaccacccc atctctgacc atgaggccac      1920
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1980
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccggcag gagatagaac      2040
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      2100
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      2160
     ggggtcatat ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      2220
     ggcccctcgt cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg      2280
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact      2340
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc      2400
     ttgtcccact gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag      2460
     cagcatccac acaggggcta atgcagcctg ggaccctgtg tgccagcact tactcttttg      2520
     tgcagcacat gtgacaatga aggacggatg tatcaccttg atggttgtgg tgttggggtc      2580
     ctgatttcag cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc      2640
     agttggtcca ggacccacac ttgctttcct cgtgtttcct gatcctgcct tgggtctgta      2700
     gtcatacttc tggaaattcc ttttgggtcc aagacgagga ggttcctcta agatctcatg      2760
     gccctgcttc ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg      2820
     agctactctc aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc      2880
     cataattcct cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac      2940
     tccagccagc gacagtgccc agggctctga tgtgtctctc acagcttgaa aaggtgagat      3000
     tcttggggtc tagagtgggc gggggggggt ggggtgggga gggggcagag gggaaaggcc      3060
     tgggtaatgg agattctttg attgggatgt ttcgcgtgtg tggtgggctg tttagagtgt      3120
     catcacttac catgactaac cagaatttgt tcatgactgt tgttttctgt agcctgagac      3180
     agctgtcttg tgagggactg agatgcagga tttcttcact cctccccttt gtgacttcaa      3240
     gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgcgtccc tgttagcata      3300
     atgtgaggag gtggagagac agcccacccc cgtgtccact gtgacccctg ttcgcatgct      3360
     gacctgtgtt tcctcccca                                                   3379
//


spacer
spacer