spacer

EBI Dbfetch

ID   AM042560; SV 1; linear; genomic DNA; STD; HUM; 1065 BP.
XX
AC   AM042560;
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-DQA1 gene for MHC class II antigen, HLA-DQA1*05new allele,
DE   exons 1-4
XX
KW   HLA-DQA1 gene; human leucocyte antigen DQA1;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1065
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (04-JUL-2005) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., van den Berg-Loonen E.M.;
RT   "New and confirmatory HLA sequences by SBT";
RL   Unpublished.
XX
DR   MD5; 0230056d5d71f8d03e17496a90f0b909.
DR   Ensembl-Gn; ENSG00000196735; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232062; homo_sapiens.
DR   Ensembl-Gn; ENSG00000257473; homo_sapiens.
DR   Ensembl-Tr; ENST00000343139; homo_sapiens.
DR   Ensembl-Tr; ENST00000374949; homo_sapiens.
DR   Ensembl-Tr; ENST00000383251; homo_sapiens.
DR   Ensembl-Tr; ENST00000395363; homo_sapiens.
DR   Ensembl-Tr; ENST00000399675; homo_sapiens.
DR   Ensembl-Tr; ENST00000399678; homo_sapiens.
DR   Ensembl-Tr; ENST00000418023; homo_sapiens.
DR   Ensembl-Tr; ENST00000444296; homo_sapiens.
DR   Ensembl-Tr; ENST00000552745; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1065
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="20700"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..82,183..428,529..810,911..1065)
FT                   /gene="HLA-DQA1"
FT                   /product="human leucocyte antigen DQA1"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01909"
FT                   /db_xref="HGNC:HGNC:4942"
FT                   /db_xref="IMGT/HLA:DQA1*05:09"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01909"
FT                   /protein_id="CAJ14961.1"
FT                   /translation="MILNKALMLGTLALTTVMSPCGGKDIVADHVASYGVNLYQSYGPS
FT                   GQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNS
FT                   TAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFL
FT                   SKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCAL
FT                   GLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL"
FT   exon            1..82
FT                   /gene="HLA-DQA1"
FT                   /number=1
FT   intron          83..182
FT                   /gene="HLA-DQA1"
FT                   /number=1
FT   exon            183..428
FT                   /gene="HLA-DQA1"
FT                   /number=2
FT   intron          429..528
FT                   /gene="HLA-DQA1"
FT                   /number=2
FT   exon            529..810
FT                   /gene="HLA-DQA1"
FT                   /number=3
FT   intron          811..910
FT                   /gene="HLA-DQA1"
FT                   /number=3
FT   exon            911..1065
FT                   /gene="HLA-DQA1"
FT                   /number=4
XX
SQ   Sequence 1065 BP; 167 A; 207 C; 191 G; 200 T; 300 other;
     atgatcctaa acaaagctct gatgctgggg acccttgccc tgaccaccgt gatgagcccc        60
     tgtggaggta aagacattgt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnctgaccac gtcgcctctt atggtgtaaa cttgtaccag tcttacggtc cctctggcca       240
     gtacacccat gaatttgatg gagatgagca gttctacgtg gacctgggga ggaaggagac       300
     tgtctggtgt ttgcctgttc tcagacaatt tagatttgac ccgcaatttg cactgacaaa       360
     catcgctgtc ctaaaacata acttgaacag tctgattaaa cgctccaact ctaccgctgc       420
     taccaatgnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnag gttcctgagg       540
     tcacagtgtt ttccaagtct cccgtgacac tgggtcagcc caacatcctc atctgtcttg       600
     tggacaacat ctttcctcct gtggtcaaca tcacatggct gagcaatggg cactcagtca       660
     cagaaggtgt ttctgagacc agcttcctct ccaagagtga tcattccttc ttcaagatca       720
     gttacctcac cctcctccct tctgctgagg agagttatga ctgcaaggtg gagcactggg       780
     gactggacaa gcctcttctg aaacactggg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn agcctgagat tccagcccct atgtcagagc tcacagagac tgtggtctgc       960
     gccctggggt tgtctgtggg cctcgtgggc attgtggtgg gcactgtctt catcatccga      1020
     ggcctgcgtt cagttggtgc ttccagacac caagggccct tgtga                      1065
//


spacer
spacer