Dbfetch

ID   AM042559; SV 1; linear; genomic DNA; STD; HUM; 1068 BP.
XX
AC   AM042559;
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-DQA1 gene for MHC class II antigen, HLA-DQA1*01new allele,
DE   exons 1-4
XX
KW   HLA-DQA1 gene; human leucocyte antigen DQA1;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1068
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (04-JUL-2005) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., van den Berg-Loonen E.M.;
RT   "New and confirmatory HLA sequences by SBT";
RL   Unpublished.
XX
DR   MD5; f95f5b7e8589f3983664bdefa5516a66.
DR   Ensembl-Gn; ENSG00000196735; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232062; homo_sapiens.
DR   Ensembl-Tr; ENST00000343139; homo_sapiens.
DR   Ensembl-Tr; ENST00000374949; homo_sapiens.
DR   Ensembl-Tr; ENST00000383251; homo_sapiens.
DR   Ensembl-Tr; ENST00000395363; homo_sapiens.
DR   Ensembl-Tr; ENST00000399675; homo_sapiens.
DR   Ensembl-Tr; ENST00000399678; homo_sapiens.
DR   Ensembl-Tr; ENST00000418023; homo_sapiens.
DR   Ensembl-Tr; ENST00000444296; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1068
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="24368"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..82,183..431,532..813,914..1068)
FT                   /gene="HLA-DQA1"
FT                   /product="human leucocyte antigen DQA1"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01909"
FT                   /db_xref="HGNC:HGNC:4942"
FT                   /db_xref="IMGT/HLA:DQA1*01:02:04"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="PDB:5KSA"
FT                   /db_xref="PDB:5KSB"
FT                   /db_xref="PDB:5KSU"
FT                   /db_xref="PDB:5KSV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01909"
FT                   /protein_id="CAJ14960.1"
FT                   /translation="MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPS
FT                   GQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYN
FT                   STAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCA
FT                   LGLSVGLMGIVVGTVFIIQGLRSVGASRHQGPL"
FT   exon            1..82
FT                   /gene="HLA-DQA1"
FT                   /number=1
FT   intron          83..182
FT                   /gene="HLA-DQA1"
FT                   /number=1
FT   exon            183..431
FT                   /gene="HLA-DQA1"
FT                   /number=2
FT   intron          432..531
FT                   /gene="HLA-DQA1"
FT                   /number=2
FT   exon            532..813
FT                   /gene="HLA-DQA1"
FT                   /number=3
FT   intron          814..913
FT                   /gene="HLA-DQA1"
FT                   /number=3
FT   exon            914..1068
FT                   /gene="HLA-DQA1"
FT                   /number=4
XX
SQ   Sequence 1068 BP; 166 A; 202 C; 202 G; 198 T; 300 other;
     atgatcctaa acaaagctct gctgctgggg gccctcgctc tgaccactgt gatgagcccc        60
     tgtggaggtg aagacattgt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnctgaccac gttgcctctt gtggtgtaaa cttgtaccag ttttacggtc cctctggcca       240
     gtacacccat gaatttgatg gagatgagca gttctacgtg gacctggaga ggaaggagac       300
     tgcctggcgg tggcctgagt tcagcaaatt tggaggtttt gacccgcagg gtgcactgag       360
     aaacatggct gtggcaaaac acaacttgaa catcatgatt aaacgctaca actctaccgc       420
     tgctaccaat gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naggttcctg       540
     aggtcacagt gttttccaag tctcccgtga cactgggtca gcccaacacc ctcatctgtc       600
     ttgtggacaa catctttcct cctgtggtca acatcacatg gctgagcaat gggcagtcag       660
     tcacagaagg tgtttctgag accagcttcc tctccaagag tgatcattcc ttcttcaaga       720
     tcagttacct caccttcctc ccttctgctg atgagattta tgactgcaag gtggagcact       780
     ggggcctgga ccagcctctt ctgaaacact gggnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnagcctga gattccagcc cctatgtcag agctcacaga gactgtggtc       960
     tgtgccctgg ggttgtctgt gggcctcatg ggcattgtgg tgggcactgt cttcatcatc      1020
     caaggcctgc gttcagttgg tgcttccaga caccaagggc cattgtga                   1068
//