Dbfetch

ID   AM039954; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM039954;
XX
DT   18-JUN-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*32 variant
DE   allele MVE0205, exons 2-3
XX
KW   HLA-A gene; HLA-A*32 variant allele MVE0205; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Blasczyk R.;
RT   ;
RL   Submitted (16-JUN-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Mueller K., Verboom M., Blasczyk R.;
RT   "A new HLA-A*32 variant.";
RL   Unpublished.
XX
DR   MD5; cd26eec505e9a3871fa9b1bdf8776599.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00011364"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*32 variant MVE0205"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*32:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QZ16"
FT                   /protein_id="CAJ01785.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAHSQTDRESLRIALRYYNQSEAGSHTIQMMYGCDVGP
FT                   DGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAAHEAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*32 variant MVE0205"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*32 variant MVE0205"
FT                   /number=3
XX
SQ   Sequence 646 BP; 109 A; 164 C; 196 G; 77 T; 100 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagactga ccgagagagc ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca gcaggacgcc tacgacggca aggattacat cgccttgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc atgaggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//