spacer

EBI Dbfetch

ID   AM039936; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   AM039936;
XX
DT   16-JUN-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*08new
DE   allele, exons 1-4, isolate MHHZ-00018426
XX
KW   HLA-B gene; HLA-B*08new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Horn P.A.;
RT   ;
RL   Submitted (15-JUN-2005) to the INSDC.
RL   Horn P.A., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Mueller K., Schlaf G., Altermann W., Blasczyk R.;
RT   "A novel HLA-B*08 allele.";
RL   Unpublished.
XX
DR   MD5; 52f90a3eafdf63d028be937cc2eac116.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00018426"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q4QZ17"
FT                   /db_xref="IMGT/HLA:B*08:25"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QZ17"
FT                   /protein_id="CAJ01770.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..>1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 187 A; 286 C; 296 G; 125 T; 301 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttcgaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacagatc ttcaagacca acacacagac tgaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag agcatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagtac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gacacgctgg agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggyttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg           1195
//


spacer
spacer